(data stored in ACNUC13479 zone)

EMBL: CP002688.LAC10

CP002688.LAC10       Location/Qualifiers
FT   CDS             join(72392..72481,72617..72768,72859..73103,73194..73322,
FT                   73434..74363,74482..74612)
FT                   /codon_start=1
FT                   /gene="LAC10"
FT                   /gene_synonym="F7J8.170"
FT                   /gene_synonym="F7J8_170"
FT                   /gene_synonym="laccase 10"
FT                   /locus_tag="AT5G01190"
FT                   /product="laccase 10"
FT                   /note="laccase 10 (LAC10); FUNCTIONS IN: laccase activity;
FT                   INVOLVED IN: oxidation reduction, lignin catabolic process;
FT                   LOCATED IN: endomembrane system, apoplast; EXPRESSED IN: 9
FT                   plant structures; EXPRESSED DURING: petal differentiation
FT                   and expansion stage; CONTAINS InterPro DOMAIN/s:
FT                   Multicopper oxidase, type 3 (InterPro:IPR011707), Laccase
FT                   (InterPro:IPR017761), Multicopper oxidase, type 2
FT                   (InterPro:IPR011706), Cupredoxin (InterPro:IPR008972),
FT                   Multicopper oxidase, copper-binding site
FT                   (InterPro:IPR002355), Multicopper oxidase, type 1
FT                   (InterPro:IPR001117); BEST Arabidopsis thaliana protein
FT                   match is: Laccase/Diphenol oxidase family protein
FT                   (TAIR:AT2G38080.1); Has 9531 Blast hits to 8327 proteins in
FT                   1383 species: Archae - 24; Bacteria - 3756; Metazoa - 439;
FT                   Fungi - 3375; Plants - 1571; Viruses - 0; Other Eukaryotes
FT                   - 366 (source: NCBI BLink)."
FT                   /db_xref="GOA:Q6ID18"
FT                   /db_xref="InterPro:IPR001117"
FT                   /db_xref="InterPro:IPR002355"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011706"
FT                   /db_xref="InterPro:IPR011707"
FT                   /db_xref="InterPro:IPR017761"
FT                   /db_xref="InterPro:IPR033138"
FT                   /db_xref="InterPro:IPR034285"
FT                   /db_xref="InterPro:IPR034288"
FT                   /db_xref="InterPro:IPR034289"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6ID18"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:AV562238.1,INSD:BP787187.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:BT014855.1"
FT                   /protein_id="AED90308.1"
FT                   /translation="MVFPIRILVLFALLAFPACVHGAIRKYTFNVVTKQVTRICSTKQI
FT                   VTVNGKFPGPTIYANEDDTILVNVVNNVKYNVSIHWHGIRQLRTGWADGPAYITQCPIK
FT                   PGHSYVYNFTVTGQRGTLWWHAHVLWLRATVHGAIVILPKLGLPYPFPKPHREEVIILG
FT                   EWWKSDTETVVNEALKSGLAPNVSDAHVINGHPGFVPNCPSQGNFKLAVESGKTYMLRL
FT                   INAALNEELFFKIAGHRFTVVEVDAVYVKPFNTDTILIAPGQTTTALVSAARPSGQYLI
FT                   AAAPFQDSAVVAVDNRTATATVHYSGTLSATPTKTTSPPPQNATSVANTFVNSLRSLNS
FT                   KTYPANVPITVDHDLLFTVGLGINRCHSCKAGNFSRVVAAINNITFKMPKTALLQAHYF
FT                   NLTGIYTTDFPAKPRRVFDFTGKPPSNLATMKATKLYKLPYNSTVQVVLQDTGNVAPEN
FT                   HPIHLHGFNFFVVGLGTGNYNSKKDSNKFNLVDPVERNTVGVPSGGWAAIRFRADNPGV
FT                   WFMHCHLEVHTTWGLKMAFLVENGKGPNQSIRPPPSDLPKC"
     MVFPIRILVL FALLAFPACV HGAIRKYTFN VVTKQVTRIC STKQIVTVNG KFPGPTIYAN        60
     EDDTILVNVV NNVKYNVSIH WHGIRQLRTG WADGPAYITQ CPIKPGHSYV YNFTVTGQRG       120
     TLWWHAHVLW LRATVHGAIV ILPKLGLPYP FPKPHREEVI ILGEWWKSDT ETVVNEALKS       180
     GLAPNVSDAH VINGHPGFVP NCPSQGNFKL AVESGKTYML RLINAALNEE LFFKIAGHRF       240
     TVVEVDAVYV KPFNTDTILI APGQTTTALV SAARPSGQYL IAAAPFQDSA VVAVDNRTAT       300
     ATVHYSGTLS ATPTKTTSPP PQNATSVANT FVNSLRSLNS KTYPANVPIT VDHDLLFTVG       360
     LGINRCHSCK AGNFSRVVAA INNITFKMPK TALLQAHYFN LTGIYTTDFP AKPRRVFDFT       420
     GKPPSNLATM KATKLYKLPY NSTVQVVLQD TGNVAPENHP IHLHGFNFFV VGLGTGNYNS       480
     KKDSNKFNLV DPVERNTVGV PSGGWAAIRF RADNPGVWFM HCHLEVHTTW GLKMAFLVEN       540
     GKGPNQSIRP PPSDLPKC                                                     558
//

If you have problems or comments...

PBIL Back to PBIL home page