(data stored in ACNUC13479 zone)

EMBL: CP002688.LAC8

CP002688.LAC8        Location/Qualifiers
FT   CDS             complement(join(13394..13578,13703..14665,14764..14874,
FT                   15191..15435,15579..15730,16044..16142))
FT                   /codon_start=1
FT                   /gene="LAC8"
FT                   /gene_synonym="F7J8.20"
FT                   /gene_synonym="F7J8_20"
FT                   /gene_synonym="laccase 8"
FT                   /locus_tag="AT5G01040"
FT                   /product="laccase 8"
FT                   /note="laccase 8 (LAC8); FUNCTIONS IN: laccase activity;
FT                   INVOLVED IN: vegetative to reproductive phase transition of
FT                   meristem, response to copper ion; LOCATED IN: endomembrane
FT                   system, apoplast; EXPRESSED IN: fruit, root, flower;
FT                   CONTAINS InterPro DOMAIN/s: Multicopper oxidase, type 2
FT                   (InterPro:IPR011706), Multicopper oxidase, type 3
FT                   (InterPro:IPR011707), Laccase (InterPro:IPR017761),
FT                   Cupredoxin (InterPro:IPR008972), Multicopper oxidase, type
FT                   1 (InterPro:IPR001117); BEST Arabidopsis thaliana protein
FT                   match is: Laccase/Diphenol oxidase family protein
FT                   (TAIR:AT5G01050.1); Has 1807 Blast hits to 1807 proteins in
FT                   277 species: Archae - 0; Bacteria - 0; Metazoa - 736; Fungi
FT                   - 347; Plants - 385; Viruses - 0; Other Eukaryotes - 339
FT                   (source: NCBI BLink)."
FT                   /db_xref="GOA:Q9LFD2"
FT                   /db_xref="InterPro:IPR001117"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011706"
FT                   /db_xref="InterPro:IPR011707"
FT                   /db_xref="InterPro:IPR017761"
FT                   /db_xref="InterPro:IPR034285"
FT                   /db_xref="InterPro:IPR034288"
FT                   /db_xref="InterPro:IPR034289"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9LFD2"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:BP628641.1,INSD:AV545019.1,INSD:EG510082.1,
FT                   INSD:BE525703.1,INSD:CB252826.1,INSD:AV539116.1,
FT                   INSD:EG510046.1,INSD:AV551119.1,INSD:AV544086.1,
FT                   INSD:EG510072.1,INSD:EG510080.1,INSD:EG510074.1,
FT                   INSD:EG510079.1,INSD:BP810741.1,INSD:AV553978.1,
FT                   INSD:BP605912.1,INSD:EG476895.1,INSD:AV553631.1,
FT                   INSD:EG510060.1,INSD:EG510048.1,INSD:AV548944.1,
FT                   INSD:EG476952.1,INSD:EL190154.1,INSD:BP616398.1,
FT                   INSD:AV784392.1,INSD:EG507809.1,INSD:AV542740.1,
FT                   INSD:EG510090.1,INSD:EL013148.1,INSD:EG426485.1,
FT                   INSD:BP801383.1,INSD:EG507815.1,INSD:BP616094.1,
FT                   INSD:AU229348.1,INSD:AV543742.1,INSD:EG507800.1,
FT                   INSD:EG510062.1,INSD:EG440606.1,INSD:EG510066.1,
FT                   INSD:AV548054.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BX832359.1,INSD:BX832175.1"
FT                   /protein_id="AED90291.1"
FT                   /translation="MPRLHHYLSNQAFLVLLLFSSIASAAVVEHVLHIQDVVVKPLCKE
FT                   QIIPAANGSLPGPTINVREGDTLVVNVINNSTYNVTIHWHGVFQLKSVWMDGANMITQC
FT                   PIQPGYNFTYQFDITGQEGTLLWHAHVVNLRATLHGALVIRPRSGRPYPFPKPYKEVPI
FT                   VFQQWWDTDVRLLQLRPAPVSDAYLINGLAGDSYPCSENRMFNLKVVQGKTYLLRIVNA
FT                   ALNTHLFFKIANHNVTVVAVDAVYSTPYLTDVMILTPGQTVDALLTADQAIGKYYMATL
FT                   PYISAIGIPTPDIKPTRGLIVYQGATSSSSPAEPLMPVPNDMSTAHRFTSNITSLVGGP
FT                   HWTPVPRHVDEKMFITMGLGLDPCPAGTKCIGPLGQRYAGSLNNRTFMIPERISMQEAY
FT                   FYNISGIYTDDFPNQPPLKFDYTKFEQRTNNDMKMMFPERKTSVKKIRFNSTVEIVLQN
FT                   TAIISPESHPMHLHGFNFYVLGYGFGNYDPIRDARKLNLFNPQMHNTVGVPPGGWVVLR
FT                   FIANNPGVWLFHCHMDAHLPYGIMSAFIVQNGPTPETSLPSPPSNLPQCTRDPTIYDSR
FT                   TTNIDLSY"
     MPRLHHYLSN QAFLVLLLFS SIASAAVVEH VLHIQDVVVK PLCKEQIIPA ANGSLPGPTI        60
     NVREGDTLVV NVINNSTYNV TIHWHGVFQL KSVWMDGANM ITQCPIQPGY NFTYQFDITG       120
     QEGTLLWHAH VVNLRATLHG ALVIRPRSGR PYPFPKPYKE VPIVFQQWWD TDVRLLQLRP       180
     APVSDAYLIN GLAGDSYPCS ENRMFNLKVV QGKTYLLRIV NAALNTHLFF KIANHNVTVV       240
     AVDAVYSTPY LTDVMILTPG QTVDALLTAD QAIGKYYMAT LPYISAIGIP TPDIKPTRGL       300
     IVYQGATSSS SPAEPLMPVP NDMSTAHRFT SNITSLVGGP HWTPVPRHVD EKMFITMGLG       360
     LDPCPAGTKC IGPLGQRYAG SLNNRTFMIP ERISMQEAYF YNISGIYTDD FPNQPPLKFD       420
     YTKFEQRTNN DMKMMFPERK TSVKKIRFNS TVEIVLQNTA IISPESHPMH LHGFNFYVLG       480
     YGFGNYDPIR DARKLNLFNP QMHNTVGVPP GGWVVLRFIA NNPGVWLFHC HMDAHLPYGI       540
     MSAFIVQNGP TPETSLPSPP SNLPQCTRDP TIYDSRTTNI DLSY                        584
//

If you have problems or comments...

PBIL Back to PBIL home page