(data stored in ACNUC13479 zone)

EMBL: CP002688.LAX1

CP002688.LAX1        Location/Qualifiers
FT   CDS             join(98228..98419,98615..98803,98931..99043,99176..99359,
FT                   99441..99538,100118..100325,100634..100891,101269..101493)
FT                   /codon_start=1
FT                   /gene="LAX1"
FT                   /gene_synonym="F7J8.220"
FT                   /gene_synonym="F7J8_220"
FT                   /gene_synonym="like AUXIN RESISTANT 1"
FT                   /locus_tag="AT5G01240"
FT                   /product="like AUXIN RESISTANT 1"
FT                   /note="like AUXIN RESISTANT 1 (LAX1); CONTAINS InterPro
FT                   DOMAIN/s: Amino acid transporter, transmembrane
FT                   (InterPro:IPR013057); BEST Arabidopsis thaliana protein
FT                   match is: Transmembrane amino acid transporter family
FT                   protein (TAIR:AT2G38120.1); Has 1807 Blast hits to 1807
FT                   proteins in 277 species: Archae - 0; Bacteria - 0; Metazoa
FT                   - 736; Fungi - 347; Plants - 385; Viruses - 0; Other
FT                   Eukaryotes - 339 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01240"
FT                   /db_xref="GOA:Q9LFB2"
FT                   /db_xref="InterPro:IPR013057"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9LFB2"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:BP787325.1,INSD:BP825250.1,INSD:BP844502.1,
FT                   INSD:AV786500.1,INSD:BP780173.1,INSD:EH860636.1,
FT                   INSD:EH878879.1,INSD:EL083575.1,INSD:DR283805.1,
FT                   INSD:BP664740.1,INSD:EL112096.1,INSD:AV821463.1,
FT                   INSD:EL239235.1,INSD:BP855385.1,INSD:BP591839.1,
FT                   INSD:BP654245.1,INSD:BP664825.1,INSD:EH972697.1,
FT                   INSD:EL155919.1,INSD:BP819900.1,INSD:BP804266.1,
FT                   INSD:BP647266.1,INSD:AV790258.1,INSD:EL063314.1,
FT                   INSD:EL022068.1,INSD:EL240342.1,INSD:EL283994.1,
FT                   INSD:BP843961.1,INSD:EH835424.1,INSD:CF773448.1,
FT                   INSD:EH846141.1,INSD:EL072648.1,INSD:BP779699.1,
FT                   INSD:BP862111.1,INSD:EL163876.1,INSD:EL215878.1,
FT                   INSD:EL170376.1,INSD:EH819666.1,INSD:BP615918.1,
FT                   INSD:EH984785.1,INSD:BP856806.1,INSD:DR283806.1,
FT                   INSD:EL187318.1,INSD:BP644678.1,INSD:AV526808.1,
FT                   INSD:BP665586.1,INSD:BP587397.1,INSD:DR376289.1,
FT                   INSD:BP868011.1,INSD:EL261982.1,INSD:EL165075.1,
FT                   INSD:EH804336.1,INSD:BP638154.1,INSD:BP659331.1,
FT                   INSD:EL014164.1,INSD:EL155882.1,INSD:BP816398.1,
FT                   INSD:BP792310.1,INSD:EH984893.1,INSD:EL253395.1,
FT                   INSD:DR363559.1,INSD:AV781921.1,INSD:EG493607.1,
FT                   INSD:BP862271.1,INSD:EL106371.1,INSD:EH938681.1,
FT                   INSD:EL150053.1,INSD:BP857703.1,INSD:EL134083.1,
FT                   INSD:EL078195.1,INSD:EH922564.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BX830652.1,INSD:BX831209.1,INSD:AJ249442.1,
FT                   INSD:BX830611.1"
FT                   /protein_id="AED90315.1"
FT                   /translation="MSGEKQAEESIVVSGEDEVAGRKVEDSAAEEDIDGNGGNGFSMKS
FT                   FLWHGGSAWDAWFSCASNQVAQVLLTLPYSFSQLGMLSGILLQIFYGLMGSWTAYLISV
FT                   LYVEYRARMEKQEAKSFKNHVIQWFEVLDGLLGPYWKAAGLAFNCTFLLFGSVIQLIAC
FT                   ASNIYYINDRLDKRTWTYIFGACCATTVFIPSFHNYRIWSFLGLGMTTYTAWYLTIASF
FT                   LHGQAEGVTHSGPTKLVLYFTGATNILYTFGGHAVTVEIMHAMWKPRKFKSIYLMATLY
FT                   VFTLTLPSASAVYWAFGDQLLNHSNAFSLLPKTRFRDTAVILMLIHQFITFGFACTPLY
FT                   FVWEKAIGMHHTKSLCLRALVRLPVVVPIWFLAIIFPFFGPINSAVGALLVTFTVYIIP
FT                   ALAHMLTYRTASARRNAAEKPPFFIPSWAGVYVINAFIVVWVLVLGFGFGGWASMTNFI
FT                   RQIDTFGLFAKCYQCKPPPAPIAAGAHHRR"
     MSGEKQAEES IVVSGEDEVA GRKVEDSAAE EDIDGNGGNG FSMKSFLWHG GSAWDAWFSC        60
     ASNQVAQVLL TLPYSFSQLG MLSGILLQIF YGLMGSWTAY LISVLYVEYR ARMEKQEAKS       120
     FKNHVIQWFE VLDGLLGPYW KAAGLAFNCT FLLFGSVIQL IACASNIYYI NDRLDKRTWT       180
     YIFGACCATT VFIPSFHNYR IWSFLGLGMT TYTAWYLTIA SFLHGQAEGV THSGPTKLVL       240
     YFTGATNILY TFGGHAVTVE IMHAMWKPRK FKSIYLMATL YVFTLTLPSA SAVYWAFGDQ       300
     LLNHSNAFSL LPKTRFRDTA VILMLIHQFI TFGFACTPLY FVWEKAIGMH HTKSLCLRAL       360
     VRLPVVVPIW FLAIIFPFFG PINSAVGALL VTFTVYIIPA LAHMLTYRTA SARRNAAEKP       420
     PFFIPSWAGV YVINAFIVVW VLVLGFGFGG WASMTNFIRQ IDTFGLFAKC YQCKPPPAPI       480
     AAGAHHRR                                                                488
//

If you have problems or comments...

PBIL Back to PBIL home page