(data stored in ACNUC13479 zone)

EMBL: CP002688.LECRKA4.1

CP002688.LECRKA4.1   Location/Qualifiers
FT   CDS             complement(211285..213333)
FT                   /codon_start=1
FT                   /gene="LECRKA4.1"
FT                   /gene_synonym="F7A7.60"
FT                   /gene_synonym="F7A7_60"
FT                   /gene_synonym="lectin receptor kinase a4.1"
FT                   /gene_synonym="L-type lectin receptor kinase-VI.2"
FT                   /gene_synonym="LecRK-VI.2"
FT                   /locus_tag="AT5G01540"
FT                   /product="lectin receptor kinase a4.1"
FT                   /note="lectin receptor kinase a4.1 (LECRKA4.1); FUNCTIONS
FT                   IN: kinase activity; INVOLVED IN: N-terminal protein
FT                   myristoylation, abscisic acid mediated signaling pathway,
FT                   response to abscisic acid stimulus, seed germination;
FT                   LOCATED IN: plasma membrane; EXPRESSED IN: 17 plant
FT                   structures; EXPRESSED DURING: 10 growth stages; CONTAINS
FT                   InterPro DOMAIN/s: Legume lectin, beta chain
FT                   (InterPro:IPR001220), Protein kinase, ATP binding site
FT                   (InterPro:IPR017441), Serine/threonine-protein kinase-like
FT                   domain (InterPro:IPR017442), Concanavalin A-like
FT                   lectin/glucanase, subgroup (InterPro:IPR013320), Protein
FT                   kinase-like domain (InterPro:IPR011009),
FT                   Serine/threonine-protein kinase, active site
FT                   (InterPro:IPR008271), Protein kinase, catalytic domain
FT                   (InterPro:IPR000719), Concanavalin A-like lectin/glucanase
FT                   (InterPro:IPR008985); BEST Arabidopsis thaliana protein
FT                   match is: lectin receptor kinase a4.1 (TAIR:AT5G01550.1);
FT                   Has 1807 Blast hits to 1807 proteins in 277 species: Archae
FT                   - 0; Bacteria - 0; Metazoa - 736; Fungi - 347; Plants -
FT                   385; Viruses - 0; Other Eukaryotes - 339 (source: NCBI
FT                   BLink)."
FT                   /db_xref="GOA:Q9M021"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001220"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9M021"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EH802774.1,INSD:EL292499.1,INSD:R64824.1,
FT                   INSD:BP816100.2,INSD:AV829852.1,INSD:BP815877.2,
FT                   INSD:AV808896.1,INSD:BP592177.1,INSD:BP592187.1,
FT                   INSD:BP829512.2,INSD:AU239076.2,INSD:N97302.1,
FT                   INSD:BP648184.1,INSD:EH913539.1,INSD:EL144779.1,
FT                   INSD:AU036593.1,INSD:EL249303.1,INSD:BP651454.1,
FT                   INSD:BP642570.1,INSD:BP645106.1,INSD:EH939393.1,
FT                   INSD:EL139251.1,INSD:BP653054.1,INSD:BP831842.1,
FT                   INSD:AU230346.1,INSD:BP835046.1,INSD:EL331798.1,
FT                   INSD:BP644703.1,INSD:AV827157.1,INSD:AI993877.1,
FT                   INSD:AV797394.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AF361597.1,INSD:BT000489.1"
FT                   /protein_id="AED90358.1"
FT                   /translation="MGTQRSMFIVSFLFKLFLFLSVHVRAQRTTTNFAFRGFNGNQSKI
FT                   RIEGAAMIKPDGLLRLTDRKSNVTGTAFYHKPVRLLNRNSTNVTIRSFSTSFVFVIIPS
FT                   SSSNKGFGFTFTLSPTPYRLNAGSAQYLGVFNKENNGDPRNHVFAVEFDTVQGSRDDNT
FT                   DRIGNDIGLNYNSRTSDLQEPVVYYNNDDHNKKEDFQLESGNPIQALLEYDGATQMLNV
FT                   TVYPARLGFKPTKPLISQHVPKLLEIVQEEMYVGFTASTGKGQSSAHYVMGWSFSSGGE
FT                   RPIADVLILSELPPPPPNKAKKEGLNSQVIVMIVALSAVMLVMLVLLFFFVMYKKRLGQ
FT                   EETLEDWEIDHPRRLRYRDLYVATDGFKKTGIIGTGGFGTVFKGKLPNSDPIAVKKIIP
FT                   SSRQGVREFVAEIESLGKLRHKNLVNLQGWCKHKNDLLLIYDYIPNGSLDSLLYTVPRR
FT                   SGAVLSWNARFQIAKGIASGLLYLHEEWEKIVIHRDVKPSNVLIDSKMNPRLGDFGLAR
FT                   LYERGTLSETTALVGTIGYMAPELSRNGNPSSASDVFAFGVLLLEIVCGRKPTDSGTFF
FT                   LVDWVMELHANGEILSAIDPRLGSGYDGGEARLALAVGLLCCHQKPASRPSMRIVLRYL
FT                   NGEENVPEIDDEWGYSKSSRSEFGSKLVGYVSSTSITRVSSTSRISQ"
     MGTQRSMFIV SFLFKLFLFL SVHVRAQRTT TNFAFRGFNG NQSKIRIEGA AMIKPDGLLR        60
     LTDRKSNVTG TAFYHKPVRL LNRNSTNVTI RSFSTSFVFV IIPSSSSNKG FGFTFTLSPT       120
     PYRLNAGSAQ YLGVFNKENN GDPRNHVFAV EFDTVQGSRD DNTDRIGNDI GLNYNSRTSD       180
     LQEPVVYYNN DDHNKKEDFQ LESGNPIQAL LEYDGATQML NVTVYPARLG FKPTKPLISQ       240
     HVPKLLEIVQ EEMYVGFTAS TGKGQSSAHY VMGWSFSSGG ERPIADVLIL SELPPPPPNK       300
     AKKEGLNSQV IVMIVALSAV MLVMLVLLFF FVMYKKRLGQ EETLEDWEID HPRRLRYRDL       360
     YVATDGFKKT GIIGTGGFGT VFKGKLPNSD PIAVKKIIPS SRQGVREFVA EIESLGKLRH       420
     KNLVNLQGWC KHKNDLLLIY DYIPNGSLDS LLYTVPRRSG AVLSWNARFQ IAKGIASGLL       480
     YLHEEWEKIV IHRDVKPSNV LIDSKMNPRL GDFGLARLYE RGTLSETTAL VGTIGYMAPE       540
     LSRNGNPSSA SDVFAFGVLL LEIVCGRKPT DSGTFFLVDW VMELHANGEI LSAIDPRLGS       600
     GYDGGEARLA LAVGLLCCHQ KPASRPSMRI VLRYLNGEEN VPEIDDEWGY SKSSRSEFGS       660
     KLVGYVSSTS ITRVSSTSRI SQ                                                682
//

If you have problems or comments...

PBIL Back to PBIL home page