(data stored in ACNUC13479 zone)

EMBL: CP002688.LECRKA4.2

CP002688.LECRKA4.2   Location/Qualifiers
FT   CDS             complement(214517..216637)
FT                   /codon_start=1
FT                   /gene="LECRKA4.2"
FT                   /gene_synonym="F7A7.70"
FT                   /gene_synonym="F7A7_70"
FT                   /gene_synonym="lectin receptor kinase a4.1"
FT                   /gene_synonym="L-type lectin receptor kinase VI.3"
FT                   /gene_synonym="LecRK-VI.3"
FT                   /locus_tag="AT5G01550"
FT                   /product="lectin receptor kinase a4.1"
FT                   /note="lectin receptor kinase a4.1 (LECRKA4.2); FUNCTIONS
FT                   IN: protein serine/threonine kinase activity, binding,
FT                   protein kinase activity, kinase activity, ATP binding;
FT                   INVOLVED IN: abscisic acid mediated signaling pathway, seed
FT                   germination; EXPRESSED IN: 6 plant structures; EXPRESSED
FT                   DURING: 4 anthesis, petal differentiation and expansion
FT                   stage; CONTAINS InterPro DOMAIN/s: Legume lectin, beta
FT                   chain (InterPro:IPR001220), Protein kinase, ATP binding
FT                   site (InterPro:IPR017441), Serine/threonine-protein
FT                   kinase-like domain (InterPro:IPR017442), Concanavalin
FT                   A-like lectin/glucanase, subgroup (InterPro:IPR013320),
FT                   Protein kinase-like domain (InterPro:IPR011009),
FT                   Serine/threonine-protein kinase, active site
FT                   (InterPro:IPR008271), Protein kinase, catalytic domain
FT                   (InterPro:IPR000719), Concanavalin A-like lectin/glucanase
FT                   (InterPro:IPR008985); BEST Arabidopsis thaliana protein
FT                   match is: lectin receptor kinase a4.3 (TAIR:AT5G01560.1);
FT                   Has 1807 Blast hits to 1807 proteins in 277 species: Archae
FT                   - 0; Bacteria - 0; Metazoa - 736; Fungi - 347; Plants -
FT                   385; Viruses - 0; Other Eukaryotes - 339 (source: NCBI
FT                   BLink)."
FT                   /db_xref="GOA:A0A2H1ZE50"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001220"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2H1ZE50"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:CD534563.1,INSD:EH945244.1,INSD:CD534897.1,
FT                   INSD:EL158919.1,INSD:EH817813.1,INSD:EH945788.1"
FT                   /protein_id="AED90359.2"
FT                   /translation="MFLMYRSLMGTARSIISFMLVLFLLLTIPTRAQRTTTETPKTEFI
FT                   FRGFSGNQSNIVTTGAATIKLDGLLRLTDRNSNVTGTSFYHKPVRLLETNTSSTNSTIR
FT                   SFSTSFVFVIIPTSSSNGGFGFTFTLSPTPDRTGAESAQYLGLLNKANDGNSTNHVFAV
FT                   EFDTVQGFKDGADRTGNHIGLNFNSLTSDVQEPVVYYDNEDPNRKEDFPLQSGDPIRAI
FT                   LDYDGPTQTLNLTVYPANLKSRPVRPLISRPVPKLSQIVQEEMYVGFTAATGRDQSSAH
FT                   YVMGWSFSSGGDLLTEDTLDLLELPRPPPNTAKKRGYNSQVLALIVALSGVTVILLALL
FT                   FFFVMYKKRLQQGEVLEDWEINHPHRLRYKDLYAATDGFKENRIVGTGGFGTVFRGNLS
FT                   SPSSDQIAVKKITPNSMQGVREFIAEIESLGRLRHKNLVNLQGWCKQKNDLLLIYDYIP
FT                   NGSLDSLLYSRPRQSGVVLSWNARFKIAKGIASGLLYLHEEWEKVVIHRDIKPSNVLIE
FT                   DDMNPRLGDFGLARLYERGSQSNTTVVVGTIGYMAPELARNGKSSSASDVFAFGVLLLE
FT                   IVSGRRPTDSGTFFLADWVMELHARGEILHAVDPRLGFGYDGVEARLALVVGLLCCHQR
FT                   PTSRPSMRTVLRYLNGDDDVPEIDNDWGYSDSSRSDLGSNFEGYVSSDRASSSVPSFSV
FT                   TRVSSSSVISGR"
     MFLMYRSLMG TARSIISFML VLFLLLTIPT RAQRTTTETP KTEFIFRGFS GNQSNIVTTG        60
     AATIKLDGLL RLTDRNSNVT GTSFYHKPVR LLETNTSSTN STIRSFSTSF VFVIIPTSSS       120
     NGGFGFTFTL SPTPDRTGAE SAQYLGLLNK ANDGNSTNHV FAVEFDTVQG FKDGADRTGN       180
     HIGLNFNSLT SDVQEPVVYY DNEDPNRKED FPLQSGDPIR AILDYDGPTQ TLNLTVYPAN       240
     LKSRPVRPLI SRPVPKLSQI VQEEMYVGFT AATGRDQSSA HYVMGWSFSS GGDLLTEDTL       300
     DLLELPRPPP NTAKKRGYNS QVLALIVALS GVTVILLALL FFFVMYKKRL QQGEVLEDWE       360
     INHPHRLRYK DLYAATDGFK ENRIVGTGGF GTVFRGNLSS PSSDQIAVKK ITPNSMQGVR       420
     EFIAEIESLG RLRHKNLVNL QGWCKQKNDL LLIYDYIPNG SLDSLLYSRP RQSGVVLSWN       480
     ARFKIAKGIA SGLLYLHEEW EKVVIHRDIK PSNVLIEDDM NPRLGDFGLA RLYERGSQSN       540
     TTVVVGTIGY MAPELARNGK SSSASDVFAF GVLLLEIVSG RRPTDSGTFF LADWVMELHA       600
     RGEILHAVDP RLGFGYDGVE ARLALVVGLL CCHQRPTSRP SMRTVLRYLN GDDDVPEIDN       660
     DWGYSDSSRS DLGSNFEGYV SSDRASSSVP SFSVTRVSSS SVISGR                      706
//

If you have problems or comments...

PBIL Back to PBIL home page