(data stored in ACNUC13479 zone)

EMBL: CP002688.LECRKA4.3

CP002688.LECRKA4.3   Location/Qualifiers
FT   CDS             complement(218170..220245)
FT                   /codon_start=1
FT                   /gene="LECRKA4.3"
FT                   /gene_synonym="F7A7.80"
FT                   /gene_synonym="F7A7_80"
FT                   /gene_synonym="lectin receptor kinase a4.3"
FT                   /gene_synonym="L-type lectin receptor kinase VI.4"
FT                   /gene_synonym="LecRK-VI.4"
FT                   /locus_tag="AT5G01560"
FT                   /product="lectin receptor kinase a4.3"
FT                   /note="lectin receptor kinase a4.3 (LECRKA4.3); FUNCTIONS
FT                   IN: kinase activity; INVOLVED IN: abscisic acid mediated
FT                   signaling pathway, seed germination; LOCATED IN:
FT                   endomembrane system; CONTAINS InterPro DOMAIN/s: Legume
FT                   lectin, beta chain (InterPro:IPR001220), Protein kinase,
FT                   ATP binding site (InterPro:IPR017441),
FT                   Serine/threonine-protein kinase-like domain
FT                   (InterPro:IPR017442), Concanavalin A-like lectin/glucanase,
FT                   subgroup (InterPro:IPR013320), Protein kinase-like domain
FT                   (InterPro:IPR011009), Serine/threonine-protein kinase,
FT                   active site (InterPro:IPR008271), Protein kinase, catalytic
FT                   domain (InterPro:IPR000719), Concanavalin A-like
FT                   lectin/glucanase (InterPro:IPR008985); BEST Arabidopsis
FT                   thaliana protein match is: lectin receptor kinase a4.1
FT                   (TAIR:AT5G01550.1); Has 124782 Blast hits to 123109
FT                   proteins in 4852 species: Archae - 131; Bacteria - 14218;
FT                   Metazoa - 45637; Fungi - 10709; Plants - 35284; Viruses -
FT                   441; Other Eukaryotes - 18362 (source: NCBI BLink)."
FT                   /db_xref="GOA:Q66GN2"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001220"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q66GN2"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:DR362574.1,INSD:EH834355.1,INSD:DR284978.1,
FT                   INSD:DR284979.1,INSD:AU229014.1,INSD:EL102384.1,
FT                   INSD:DR362576.1,INSD:ES163378.1,INSD:DR284976.1,
FT                   INSD:ES121584.1,INSD:EL315375.1,INSD:DR284983.1,
FT                   INSD:EL968859.1,INSD:DR362575.1,INSD:DR362573.1,
FT                   INSD:DR383078.1,INSD:BP806064.1,INSD:DR284981.1,
FT                   INSD:AV539856.1,INSD:DR284984.1,INSD:DR284971.1,
FT                   INSD:EL115538.1,INSD:EL041740.1,INSD:DR284975.1,
FT                   INSD:ES056429.1,INSD:AU237906.1,INSD:DR284982.1,
FT                   INSD:DR284980.1,INSD:DR284974.1,INSD:BE038489.1,
FT                   INSD:DR284969.1,INSD:DR284972.1,INSD:DR280931.1,
FT                   INSD:DR284977.1,INSD:DR280932.1,INSD:ES034744.1,
FT                   INSD:CB259719.1,INSD:ES085305.1,INSD:DR284973.1,
FT                   INSD:DR284970.1,INSD:EL120899.1,INSD:DR383090.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BX831757.1,INSD:BT015370.1"
FT                   /protein_id="AED90360.1"
FT                   /translation="MGRAKSMVSLLLVLFLVRAHVATTETTTEFIFHGFKGNQSEIHMQ
FT                   GDSTITSNGLLRLTDRNSDVVGTAFYHKPVRLLDSNSTNTTVRSFSTSFIFIIPSSSTS
FT                   NGGFGFTFTLSPTPNRTDADPEQYMGLLNERNDGNSSNHVFAVEFDTVQGFKDGTNRIG
FT                   NHIGLNFNSLSSDVQEPVAYFNNNDSQKEEFQLVSGEPIQVFLDYHGPTKTLNLTVYPT
FT                   RLGYKPRIPLISREVPKLSDIVVDEMFVGFTAATGRHGQSSAHYVMGWSFASGGEHPLA
FT                   AMLDISQLPPPPPNKAKKRGYNGKVIALIVALSTVISIMLVLLFLFMMYKKRMQQEEIL
FT                   EDWEIDHPHRFRYRDLYKATEGFKENRVVGTGGFGIVYRGNIRSSSDQIAVKKITPNSM
FT                   QGVREFVAEIESLGRLRHKNLVNLQGWCKHRNDLLLIYDYIPNGSLDSLLYSKPRRSGA
FT                   VLSWNARFQIAKGIASGLLYLHEEWEQIVIHRDVKPSNVLIDSDMNPRLGDFGLARLYE
FT                   RGSQSCTTVVVGTIGYMAPELARNGNSSSASDVFAFGVLLLEIVSGRKPTDSGTFFIAD
FT                   WVMELQASGEILSAIDPRLGSGYDEGEARLALAVGLLCCHHKPESRPLMRMVLRYLNRD
FT                   EDVPEIHDNWGYSDSSRTDLGSKLVGYISSDRASSSHSHTSSSLTRISSTSLISGR"
     MGRAKSMVSL LLVLFLVRAH VATTETTTEF IFHGFKGNQS EIHMQGDSTI TSNGLLRLTD        60
     RNSDVVGTAF YHKPVRLLDS NSTNTTVRSF STSFIFIIPS SSTSNGGFGF TFTLSPTPNR       120
     TDADPEQYMG LLNERNDGNS SNHVFAVEFD TVQGFKDGTN RIGNHIGLNF NSLSSDVQEP       180
     VAYFNNNDSQ KEEFQLVSGE PIQVFLDYHG PTKTLNLTVY PTRLGYKPRI PLISREVPKL       240
     SDIVVDEMFV GFTAATGRHG QSSAHYVMGW SFASGGEHPL AAMLDISQLP PPPPNKAKKR       300
     GYNGKVIALI VALSTVISIM LVLLFLFMMY KKRMQQEEIL EDWEIDHPHR FRYRDLYKAT       360
     EGFKENRVVG TGGFGIVYRG NIRSSSDQIA VKKITPNSMQ GVREFVAEIE SLGRLRHKNL       420
     VNLQGWCKHR NDLLLIYDYI PNGSLDSLLY SKPRRSGAVL SWNARFQIAK GIASGLLYLH       480
     EEWEQIVIHR DVKPSNVLID SDMNPRLGDF GLARLYERGS QSCTTVVVGT IGYMAPELAR       540
     NGNSSSASDV FAFGVLLLEI VSGRKPTDSG TFFIADWVME LQASGEILSA IDPRLGSGYD       600
     EGEARLALAV GLLCCHHKPE SRPLMRMVLR YLNRDEDVPE IHDNWGYSDS SRTDLGSKLV       660
     GYISSDRASS SHSHTSSSLT RISSTSLISG R                                      691
//

If you have problems or comments...

PBIL Back to PBIL home page