(data stored in ACNUC13479 zone)

EMBL: CP002688.MAN6

CP002688.MAN6        Location/Qualifiers
FT   CDS             complement(join(361189..361627,361726..362060,
FT                   362146..362340,362413..362689,362767..362867))
FT                   /codon_start=1
FT                   /gene="MAN6"
FT                   /gene_synonym="T20L15.200"
FT                   /gene_synonym="T20L15_200"
FT                   /gene_synonym="AtMAN6"
FT                   /gene_synonym="endo-beta-mannase 6"
FT                   /locus_tag="AT5G01930"
FT                   /product="Glycosyl hydrolase superfamily protein"
FT                   /note="Glycosyl hydrolase superfamily protein; FUNCTIONS
FT                   IN: cation binding, hydrolase activity, hydrolyzing
FT                   O-glycosyl compounds, catalytic activity; INVOLVED IN:
FT                   carbohydrate metabolic process; LOCATED IN: endomembrane
FT                   system; EXPRESSED IN: 19 plant structures; EXPRESSED
FT                   DURING: 10 growth stages; CONTAINS InterPro DOMAIN/s:
FT                   Glycoside hydrolase, catalytic core (InterPro:IPR017853),
FT                   Glycoside hydrolase, family 5 (InterPro:IPR001547),
FT                   Glycoside hydrolase, subgroup, catalytic core
FT                   (InterPro:IPR013781); BEST Arabidopsis thaliana protein
FT                   match is: Glycosyl hydrolase superfamily protein
FT                   (TAIR:AT5G66460.1); Has 1807 Blast hits to 1807 proteins in
FT                   277 species: Archae - 0; Bacteria - 0; Metazoa - 736; Fungi
FT                   - 347; Plants - 385; Viruses - 0; Other Eukaryotes - 339
FT                   (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01930"
FT                   /db_xref="GOA:Q9LZV3"
FT                   /db_xref="InterPro:IPR001547"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9LZV3"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:DR275249.1,INSD:EH934159.1,INSD:AA597792.1,
FT                   INSD:BP807570.1,INSD:EL989024.1,INSD:CF652410.1,
FT                   INSD:BP578231.1,INSD:AU225967.1,INSD:DR275248.1,
FT                   INSD:BP858373.1,INSD:AA713141.1,INSD:BP583233.1,
FT                   INSD:AA394852.1,INSD:BP572699.1,INSD:BP571628.1,
FT                   INSD:AU235301.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BT005831.1,INSD:BT011805.1,INSD:AK227325.1"
FT                   /protein_id="AED90411.1"
FT                   /translation="MKDQLGFRIVLCSAVFIILTQNRALADLDSESHEVNSESVGEEQW
FT                   EMVQRKGMQFTLNGQPFYVNGFNTYWMMTLAADNSTRGKVTEVFQQASAVGMTVGRTWA
FT                   FNDGQWRALQKSPSVYDEEVFKALDFVLSEARKYKIRLILSLVNNWDAYGGKAQYVKWG
FT                   NASGLNLTSDDDFFTNPTLRNFYQSHVRTVLNRVNTFTNITYKNDPTIFAWELMNEPRC
FT                   PSDPSGDKLQSWIQEMAVFVKSLDAKHLVEIGLEGFYGPSAPARTRFNPNPYAAQVGTD
FT                   FIRNNQVLGIDFASVHVYPDSWISPAVSNSFLEFTSSWMQAHVEDAEMYLGMPVLFTEF
FT                   GVSAHDPGFNTSFRDMMLNTVYKMTLNSTRKGGAGAGSLVWQVFPQGAEFMDDGYAVYL
FT                   TRAHTASKIISLQSKRLAIFNSLCSWRCRWGCKKKNQTALDALLSHDEL"
     MKDQLGFRIV LCSAVFIILT QNRALADLDS ESHEVNSESV GEEQWEMVQR KGMQFTLNGQ        60
     PFYVNGFNTY WMMTLAADNS TRGKVTEVFQ QASAVGMTVG RTWAFNDGQW RALQKSPSVY       120
     DEEVFKALDF VLSEARKYKI RLILSLVNNW DAYGGKAQYV KWGNASGLNL TSDDDFFTNP       180
     TLRNFYQSHV RTVLNRVNTF TNITYKNDPT IFAWELMNEP RCPSDPSGDK LQSWIQEMAV       240
     FVKSLDAKHL VEIGLEGFYG PSAPARTRFN PNPYAAQVGT DFIRNNQVLG IDFASVHVYP       300
     DSWISPAVSN SFLEFTSSWM QAHVEDAEMY LGMPVLFTEF GVSAHDPGFN TSFRDMMLNT       360
     VYKMTLNSTR KGGAGAGSLV WQVFPQGAEF MDDGYAVYLT RAHTASKIIS LQSKRLAIFN       420
     SLCSWRCRWG CKKKNQTALD ALLSHDEL                                          448
//

If you have problems or comments...

PBIL Back to PBIL home page