(data stored in ACNUC13479 zone)

EMBL: CP002688.MSFC1

CP002688.MSFC1       Location/Qualifiers
FT   CDS             complement(join(143240..143779,144172..144561))
FT                   /codon_start=1
FT                   /gene="mSFC1"
FT                   /gene_synonym="T10O8.50"
FT                   /gene_synonym="T10O8_50"
FT                   /gene_synonym="AtmSFC1"
FT                   /gene_synonym="mitochondrial succinate-fumarate carrier 1"
FT                   /locus_tag="AT5G01340"
FT                   /product="Mitochondrial substrate carrier family protein"
FT                   /note="Mitochondrial substrate carrier family protein;
FT                   FUNCTIONS IN: transporter activity, binding; INVOLVED IN:
FT                   transport, mitochondrial transport, transmembrane
FT                   transport; LOCATED IN: mitochondrial inner membrane,
FT                   membrane; EXPRESSED IN: 23 plant structures; EXPRESSED
FT                   DURING: 15 growth stages; CONTAINS InterPro DOMAIN/s:
FT                   Mitochondrial substrate carrier (InterPro:IPR001993),
FT                   Mitochondrial substrate/solute carrier
FT                   (InterPro:IPR018108), Adenine nucleotide translocator 1
FT                   (InterPro:IPR002113); BEST Arabidopsis thaliana protein
FT                   match is: Mitochondrial substrate carrier family protein
FT                   (TAIR:AT2G37890.1); Has 1807 Blast hits to 1807 proteins in
FT                   277 species: Archae - 0; Bacteria - 0; Metazoa - 736; Fungi
FT                   - 347; Plants - 385; Viruses - 0; Other Eukaryotes - 339
FT                   (source: NCBI BLink)."
FT                   /db_xref="GOA:Q9M038"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="InterPro:IPR023395"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9M038"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:AV824691.1,INSD:BP613840.1,INSD:BE525332.1,
FT                   INSD:AV787271.1,INSD:BP573641.1,INSD:BP578014.1,
FT                   INSD:DR376063.1,INSD:BP861137.1,INSD:BP581523.1,
FT                   INSD:BE529162.1,INSD:BP617797.1,INSD:BP575310.1,
FT                   INSD:BP574822.1,INSD:BP573328.1,INSD:BP800796.1,
FT                   INSD:DR229198.1,INSD:BP577372.1,INSD:DR229196.1,
FT                   INSD:BP567232.1,INSD:EL184388.1,INSD:BP802625.1,
FT                   INSD:AV530956.1,INSD:DR229195.1,INSD:BP576104.1,
FT                   INSD:DR229194.1,INSD:DR229197.1,INSD:DR229199.1,
FT                   INSD:EL308005.1,INSD:BP849972.1,INSD:AV556481.1,
FT                   INSD:BP804700.1,INSD:ES045272.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY052716.1,INSD:AY098957.1,INSD:BX833134.1,
FT                   INSD:AY087702.1"
FT                   /protein_id="AED90329.1"
FT                   /translation="MATRTESKKQIPPYMKAVSGSLGGVVEACCLQPIDVIKTRLQLDR
FT                   VGAYKGIAHCGSKVVRTEGVRALWKGLTPFATHLTLKYTLRMGSNAMFQTAFKDSETGK
FT                   VSNRGRFLSGFGAGVLEALAIVTPFEVVKIRLQQQKGLSPELFKYKGPIHCARTIVREE
FT                   SILGLWSGAAPTVMRNGTNQAVMFTAKNAFDILLWNKHEGDGKILQPWQSMISGFLAGT
FT                   AGPFCTGPFDVVKTRLMAQSRDSEGGIRYKGMVHAIRTIYAEEGLVALWRGLLPRLMRI
FT                   PPGQAIMWAVADQVTGLYEMRYLRNAPL"
     MATRTESKKQ IPPYMKAVSG SLGGVVEACC LQPIDVIKTR LQLDRVGAYK GIAHCGSKVV        60
     RTEGVRALWK GLTPFATHLT LKYTLRMGSN AMFQTAFKDS ETGKVSNRGR FLSGFGAGVL       120
     EALAIVTPFE VVKIRLQQQK GLSPELFKYK GPIHCARTIV REESILGLWS GAAPTVMRNG       180
     TNQAVMFTAK NAFDILLWNK HEGDGKILQP WQSMISGFLA GTAGPFCTGP FDVVKTRLMA       240
     QSRDSEGGIR YKGMVHAIRT IYAEEGLVAL WRGLLPRLMR IPPGQAIMWA VADQVTGLYE       300
     MRYLRNAPL                                                               309
//

If you have problems or comments...

PBIL Back to PBIL home page