(data stored in ACNUC13479 zone)

EMBL: CP002688.OFP1

CP002688.OFP1        Location/Qualifiers
FT   CDS             324552..325364
FT                   /codon_start=1
FT                   /gene="OFP1"
FT                   /gene_synonym="ARABIDOPSIS THALIANA OVATE FAMILY PROTEIN 1"
FT                   /gene_synonym="ATOFP1"
FT                   /gene_synonym="ovate family protein 1"
FT                   /gene_synonym="T20L15.110"
FT                   /gene_synonym="T20L15_110"
FT                   /locus_tag="AT5G01840"
FT                   /product="ovate family protein 1"
FT                   /note="ovate family protein 1 (OFP1); FUNCTIONS IN: protein
FT                   binding, transcription repressor activity; INVOLVED IN:
FT                   N-terminal protein myristoylation, regulation of
FT                   unidimensional cell growth; LOCATED IN: nucleolus,
FT                   cytoskeleton; EXPRESSED IN: 14 plant structures; EXPRESSED
FT                   DURING: 4 anthesis, F mature embryo stage, petal
FT                   differentiation and expansion stage, E expanded cotyledon
FT                   stage, D bilateral stage; CONTAINS InterPro DOMAIN/s:
FT                   Protein of unknown function DUF623 (InterPro:IPR006458);
FT                   BEST Arabidopsis thaliana protein match is: ovate family
FT                   protein 3 (TAIR:AT5G58360.1); Has 1807 Blast hits to 1807
FT                   proteins in 277 species: Archae - 0; Bacteria - 0; Metazoa
FT                   - 736; Fungi - 347; Plants - 385; Viruses - 0; Other
FT                   Eukaryotes - 339 (source: NCBI BLink)."
FT                   /db_xref="GOA:Q9LZW2"
FT                   /db_xref="InterPro:IPR006458"
FT                   /db_xref="InterPro:IPR025830"
FT                   /db_xref="InterPro:IPR038933"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9LZW2"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:AU226103.1,INSD:ES086497.1,INSD:ES136487.1,
FT                   INSD:AV549614.1,INSD:ES194491.1,INSD:AV537628.1,
FT                   INSD:ES171740.1"
FT                   /protein_id="AED90399.1"
FT                   /translation="MGNNYRFKLSELIPNAWFYKLRDMSKSKKKNLQSQPNSTTSKKKH
FT                   HAVPTPTSTTPLSPRPPRRPSHSSKAPPSHPPRKSSGNRLRHRATVDSKSSTTSGDSTT
FT                   TETGSFSPDFRSDQVLLPDESLTGSWHSPCSSKLSKTATFTPPPELELRPIITKTAATA
FT                   RKTAVNSPAGVRLRMRSPRISVSSSARRSGSSARRSRAVVKASVDPKRDFKESMEEMIA
FT                   ENKIRATKDLEELLACYLCLNSDEYHAIIINVFKQIWLDLNLPPPHSK"
     MGNNYRFKLS ELIPNAWFYK LRDMSKSKKK NLQSQPNSTT SKKKHHAVPT PTSTTPLSPR        60
     PPRRPSHSSK APPSHPPRKS SGNRLRHRAT VDSKSSTTSG DSTTTETGSF SPDFRSDQVL       120
     LPDESLTGSW HSPCSSKLSK TATFTPPPEL ELRPIITKTA ATARKTAVNS PAGVRLRMRS       180
     PRISVSSSAR RSGSSARRSR AVVKASVDPK RDFKESMEEM IAENKIRATK DLEELLACYL       240
     CLNSDEYHAI IINVFKQIWL DLNLPPPHSK                                        270
//

If you have problems or comments...

PBIL Back to PBIL home page