(data stored in ACNUC13479 zone)

EMBL: CP002688.OSH1

CP002688.OSH1        Location/Qualifiers
FT   CDS             complement(join(222760..222921,223003..223095,
FT                   223203..223340,223460..223525,223610..223852))
FT                   /codon_start=1
FT                   /gene="OSH1"
FT                   /gene_synonym="F7A7.100"
FT                   /gene_synonym="F7A7_100"
FT                   /gene_synonym="OAS HIGH ACCUMULATION 1"
FT                   /locus_tag="AT5G01580"
FT                   /product="gamma interferon responsive lysosomal thiol
FT                   (GILT) reductase family protein"
FT                   /note="OAS HIGH ACCUMULATION 1 (OSH1); FUNCTIONS IN:
FT                   catalytic activity; INVOLVED IN: biological_process
FT                   unknown; LOCATED IN: endomembrane system; CONTAINS InterPro
FT                   DOMAIN/s: Gamma interferon inducible lysosomal thiol
FT                   reductase GILT (InterPro:IPR004911); BEST Arabidopsis
FT                   thaliana protein match is: Thioredoxin superfamily protein
FT                   (TAIR:AT1G07080.1); Has 1807 Blast hits to 1807 proteins in
FT                   277 species: Archae - 0; Bacteria - 0; Metazoa - 736; Fungi
FT                   - 347; Plants - 385; Viruses - 0; Other Eukaryotes - 339
FT                   (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01580"
FT                   /db_xref="InterPro:IPR004911"
FT                   /db_xref="UniProtKB/TrEMBL:Q9M017"
FT                   /inference="similar to RNA sequence, EST:INSD:EG498736.1"
FT                   /protein_id="AED90362.1"
FT                   /translation="MASYQRLCITSCTIFFCLLSLSSSQKVTLSLYYEALCPFCAEFIV
FT                   NRLPKIFETGLISSIDLQLVPWGNAAIRPDGTILCQHGEAECALNAIHACAINAYPDVM
FT                   KHFGYIYCTEQLVLENKLEKWADCLEMVGLSRAAVDCYINGYGNQLEQRYAEETSELYP
FT                   AHRFVPWVVVNNLPLQENYQNFVMYVCNAYGSNQVPEACRILNSSVETLSRSNSSVEKL
FT                   SNSPQVCYSNH"
     MASYQRLCIT SCTIFFCLLS LSSSQKVTLS LYYEALCPFC AEFIVNRLPK IFETGLISSI        60
     DLQLVPWGNA AIRPDGTILC QHGEAECALN AIHACAINAY PDVMKHFGYI YCTEQLVLEN       120
     KLEKWADCLE MVGLSRAAVD CYINGYGNQL EQRYAEETSE LYPAHRFVPW VVVNNLPLQE       180
     NYQNFVMYVC NAYGSNQVPE ACRILNSSVE TLSRSNSSVE KLSNSPQVCY SNH              233
//

If you have problems or comments...

PBIL Back to PBIL home page