(data stored in ACNUC13479 zone)

EMBL: CP002688.PDC3

CP002688.PDC3        Location/Qualifiers
FT   CDS             complement(join(132538..132708,132790..133096,
FT                   133369..134019,134093..134256,134322..134807))
FT                   /codon_start=1
FT                   /gene="PDC3"
FT                   /gene_synonym="pyruvate decarboxylase-3"
FT                   /gene_synonym="PYRUVATE DECARBOXYLASE-3"
FT                   /gene_synonym="T10O8.40"
FT                   /gene_synonym="T10O8_40"
FT                   /locus_tag="AT5G01330"
FT                   /product="pyruvate decarboxylase-3"
FT                   /note="pyruvate decarboxylase-3 (PDC3); FUNCTIONS IN: in 6
FT                   functions; CONTAINS InterPro DOMAIN/s: TPP-binding enzyme,
FT                   conserved site (InterPro:IPR000399), Thiamine pyrophosphate
FT                   enzyme, central domain (InterPro:IPR012000), Pyruvate
FT                   decarboxylase/indolepyruvate decarboxylase
FT                   (InterPro:IPR012110), Thiamine pyrophosphate enzyme,
FT                   N-terminal TPP-binding domain (InterPro:IPR012001),
FT                   Thiamine pyrophosphate enzyme, C-terminal TPP-binding
FT                   (InterPro:IPR011766); BEST Arabidopsis thaliana protein
FT                   match is: Thiamine pyrophosphate dependent pyruvate
FT                   decarboxylase family protein (TAIR:AT5G01320.1); Has 1807
FT                   Blast hits to 1807 proteins in 277 species: Archae - 0;
FT                   Bacteria - 0; Metazoa - 736; Fungi - 347; Plants - 385;
FT                   Viruses - 0; Other Eukaryotes - 339 (source: NCBI BLink)."
FT                   /db_xref="GOA:Q9M039"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012110"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9M039"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:CK121737.1,INSD:BP800589.1,INSD:AU235633.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AK227701.1,INSD:BT006455.1"
FT                   /protein_id="AED90328.1"
FT                   /translation="MDVRSLPSNGVATIQDSAPTAATILGSSAATLGRHLSRRLVQAGV
FT                   TDIFTVPGDFNLSLLDQLIANPELNNIGCCNELNAGYAADGYARSRGVGACVVTFTVGG
FT                   LSVLNAIAGAYSENLPVICIVGGPNSNDFGTNRILHHTIGLPDFSQELRCFQTVTCYQA
FT                   VVNHLEDAHEQIDKAIATALRESKPVYISISCNLAAIPHPTFASYPVPFDLTPRLSNKD
FT                   CLEAAVEATLEFLNKAVKPVMVGGPKLRVAKARDAFVELADASGYPVAVMPSAKGFVPE
FT                   NHPHFIGTYWGAVSTLFCSEIVESADAYIFAGPIFNDYSSVGYSLLLKKEKAIIVHPDS
FT                   VVVANGPTFGCVRMSEFFRELAKRVKPNKTAYENYHRIFVPEGKPLKCKPREPLRINAM
FT                   FQHIQKMLSNETAVIAETGDSWFNCQKLKLPKGCGYEFQMQYGSIGWSVGATLGYAQAT
FT                   PEKRVLSFIGDGSFQVTAQDVSTMIRNGQKTIIFLINNGGYTIEVEIHDGPYNVIKNWN
FT                   YTGLVDAIHNGEGKCWTTKVRYEEELVEAINTATLEKKDSLCFIEVIVHKDDTSKELLE
FT                   WGSRVSAANGRPPNPQ"
     MDVRSLPSNG VATIQDSAPT AATILGSSAA TLGRHLSRRL VQAGVTDIFT VPGDFNLSLL        60
     DQLIANPELN NIGCCNELNA GYAADGYARS RGVGACVVTF TVGGLSVLNA IAGAYSENLP       120
     VICIVGGPNS NDFGTNRILH HTIGLPDFSQ ELRCFQTVTC YQAVVNHLED AHEQIDKAIA       180
     TALRESKPVY ISISCNLAAI PHPTFASYPV PFDLTPRLSN KDCLEAAVEA TLEFLNKAVK       240
     PVMVGGPKLR VAKARDAFVE LADASGYPVA VMPSAKGFVP ENHPHFIGTY WGAVSTLFCS       300
     EIVESADAYI FAGPIFNDYS SVGYSLLLKK EKAIIVHPDS VVVANGPTFG CVRMSEFFRE       360
     LAKRVKPNKT AYENYHRIFV PEGKPLKCKP REPLRINAMF QHIQKMLSNE TAVIAETGDS       420
     WFNCQKLKLP KGCGYEFQMQ YGSIGWSVGA TLGYAQATPE KRVLSFIGDG SFQVTAQDVS       480
     TMIRNGQKTI IFLINNGGYT IEVEIHDGPY NVIKNWNYTG LVDAIHNGEG KCWTTKVRYE       540
     EELVEAINTA TLEKKDSLCF IEVIVHKDDT SKELLEWGSR VSAANGRPPN PQ               592
//

If you have problems or comments...

PBIL Back to PBIL home page