(data stored in ACNUC13479 zone)

EMBL: CP002688.PE1

CP002688.PE1         Location/Qualifiers
FT   CDS             complement(join(1388..1459,1572..1646,1745..1780,
FT                   1914..2007,2105..2181,2435..2509,2748..2799,2872..2934,
FT                   3303..3383,3543..3659,3762..3802,3927..4005,4102..4237,
FT                   4335..4467,4552..4679,4765..4924))
FT                   /codon_start=1
FT                   /gene_synonym="TOPTELOMERE.1"
FT                   /gene_synonym="TOPTELOMERE_1"
FT                   /locus_tag="AT5G01010"
FT                   /product="retinal-binding protein"
FT                   /note="EXPRESSED IN: 23 plant structures; EXPRESSED DURING:
FT                   14 growth stages; CONTAINS InterPro DOMAIN/s: GOLD
FT                   (InterPro:IPR009038)."
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01010"
FT                   /db_xref="EnsemblGenomes-Tr:AT5G01010.4"
FT                   /db_xref="InterPro:IPR009038"
FT                   /db_xref="InterPro:IPR036598"
FT                   /db_xref="UniProtKB/TrEMBL:F4K7W4"
FT                   /protein_id="AED90285.1"
FT                   /translation="MASTEGLMPITRAFLASYYDKYPFSPLSDDVSRLSSDMASLIKLL
FT                   TVQSPPSQGETSLIDEANRQPPHKIDENMWKNREQMEEILFLLSPSRWPVQLREPSTSE
FT                   DAEFASILRTLKDSFDNAFTAMISFQTKNSERIFSTDFRGTLIRQQKERSERNKQAEVD
FT                   ALVSSGGSIRDTYALLWKQQMERRRQLAQLGSATGVYKTLVKYLVGVPQVLLDFIRQIN
FT                   DDDGPMEEQRERYGPPLYSLTKMVIAIRVFLTLLWERYDTFKLSKDQMNLLSEAAIVYT
FT                   SEFERFVTFISDVFANSPFFISADTAGILWSRDNEEYKEIIVQAGRTYEISLMVESENS
FT                   YIAWDFSLMQGKISMLPYIRFLLLYLLLFLPDSGYLCFHTYFCCLSSVYISVVFYQDIG
FT                   FSVEYINASGEKTLILPYRRYEADQGNFSTLMAGNYKLVWDNSYSTFFKKTLRYKVDCI
FT                   APVVEPDPEPEPLN"
     MASTEGLMPI TRAFLASYYD KYPFSPLSDD VSRLSSDMAS LIKLLTVQSP PSQGETSLID        60
     EANRQPPHKI DENMWKNREQ MEEILFLLSP SRWPVQLREP STSEDAEFAS ILRTLKDSFD       120
     NAFTAMISFQ TKNSERIFST DFRGTLIRQQ KERSERNKQA EVDALVSSGG SIRDTYALLW       180
     KQQMERRRQL AQLGSATGVY KTLVKYLVGV PQVLLDFIRQ INDDDGPMEE QRERYGPPLY       240
     SLTKMVIAIR VFLTLLWERY DTFKLSKDQM NLLSEAAIVY TSEFERFVTF ISDVFANSPF       300
     FISADTAGIL WSRDNEEYKE IIVQAGRTYE ISLMVESENS YIAWDFSLMQ GKISMLPYIR       360
     FLLLYLLLFL PDSGYLCFHT YFCCLSSVYI SVVFYQDIGF SVEYINASGE KTLILPYRRY       420
     EADQGNFSTL MAGNYKLVWD NSYSTFFKKT LRYKVDCIAP VVEPDPEPEP LN               472
//

If you have problems or comments...

PBIL Back to PBIL home page