(data stored in ACNUC13479 zone)

EMBL: CP002688.PE103

CP002688.PE103       Location/Qualifiers
FT   CDS             join(221367..221538,221607..221748,221828..221929,
FT                   222068..222141,222244..222327,222640..222669,
FT                   222764..222798)
FT                   /codon_start=1
FT                   /gene_synonym="F7A7.90"
FT                   /gene_synonym="F7A7_90"
FT                   /locus_tag="AT5G01570"
FT                   /product="plectin-like protein"
FT                   /note="unknown protein; BEST Arabidopsis thaliana protein
FT                   match is: unknown protein (TAIR:AT3G08880.1); Has 1807
FT                   Blast hits to 1807 proteins in 277 species: Archae - 0;
FT                   Bacteria - 0; Metazoa - 736; Fungi - 347; Plants - 385;
FT                   Viruses - 0; Other Eukaryotes - 339 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01570"
FT                   /db_xref="GOA:F4K9F4"
FT                   /db_xref="UniProtKB/TrEMBL:F4K9F4"
FT                   /inference="similar to RNA sequence, EST:INSD:EG421705.1"
FT                   /protein_id="AED90361.2"
FT                   /translation="MRDQSRNFEMVISWGDELIHVLDDRKGFDVLVQTLEQLRAIPFSC
FT                   DEDFKEIHESLQDLQKKLDVCKEKTDEANSEIADEEEIERLQKELDEELELECKLKEEL
FT                   RFIADELKDLNSQEALFEEHRLAIKRNKRDQLRTETKLPMYASVTRVIPNIDDSLKTSG
FT                   YMVGRDKRLMDKFEFDSNKSTSVYETCNERIGEEQILTVIGIANLGTVT"
     MRDQSRNFEM VISWGDELIH VLDDRKGFDV LVQTLEQLRA IPFSCDEDFK EIHESLQDLQ        60
     KKLDVCKEKT DEANSEIADE EEIERLQKEL DEELELECKL KEELRFIADE LKDLNSQEAL       120
     FEEHRLAIKR NKRDQLRTET KLPMYASVTR VIPNIDDSLK TSGYMVGRDK RLMDKFEFDS       180
     NKSTSVYETC NERIGEEQIL TVIGIANLGT VT                                     212
//

If you have problems or comments...

PBIL Back to PBIL home page