(data stored in ACNUC13479 zone)

EMBL: CP002688.PE105

CP002688.PE105       Location/Qualifiers
FT   CDS             join(221367..221538,221607..221748,221828..221929,
FT                   222068..222141,222244..222356)
FT                   /codon_start=1
FT                   /gene_synonym="F7A7.90"
FT                   /gene_synonym="F7A7_90"
FT                   /locus_tag="AT5G01570"
FT                   /product="plectin-like protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1P8BFF1"
FT                   /protein_id="ANM70328.1"
FT                   /translation="MRDQSRNFEMVISWGDELIHVLDDRKGFDVLVQTLEQLRAIPFSC
FT                   DEDFKEIHESLQDLQKKLDVCKEKTDEANSEIADEEEIERLQKELDEELELECKLKEEL
FT                   RFIADELKDLNSQEALFEEHRLAIKRNKRDQLRTETKLPMYASVTRVIPNIDDSLKTSG
FT                   YMVGRDKRLMDKFEFDSNKSTSVYETCNGIWDIINRQ"
     MRDQSRNFEM VISWGDELIH VLDDRKGFDV LVQTLEQLRA IPFSCDEDFK EIHESLQDLQ        60
     KKLDVCKEKT DEANSEIADE EEIERLQKEL DEELELECKL KEELRFIADE LKDLNSQEAL       120
     FEEHRLAIKR NKRDQLRTET KLPMYASVTR VIPNIDDSLK TSGYMVGRDK RLMDKFEFDS       180
     NKSTSVYETC NGIWDIINRQ                                                   200
//

If you have problems or comments...

PBIL Back to PBIL home page