(data stored in ACNUC13479 zone)

EMBL: CP002688.PE109

CP002688.PE109       Location/Qualifiers
FT   CDS             join(224249..224942,225406..225603,225723..226005,
FT                   226096..226258,226375..226620)
FT                   /codon_start=1
FT                   /gene_synonym="F7A7.110"
FT                   /gene_synonym="F7A7_110"
FT                   /gene_synonym="TIC56"
FT                   /gene_synonym="TRANSLOCON AT THE INNER ENVELOPE MEMBRANE OF
FT                   CHLOROPLASTS 56"
FT                   /locus_tag="AT5G01590"
FT                   /product="histone-lysine N-methyltransferase ATXR3-like
FT                   protein"
FT                   /note="unknown protein; FUNCTIONS IN: molecular_function
FT                   unknown; INVOLVED IN: biological_process unknown; LOCATED
FT                   IN: chloroplast, chloroplast envelope; EXPRESSED IN: 22
FT                   plant structures; EXPRESSED DURING: 13 growth stages; Has
FT                   60 Blast hits to 59 proteins in 31 species: Archae - 0;
FT                   Bacteria - 20; Metazoa - 1; Fungi - 2; Plants - 33; Viruses
FT                   - 0; Other Eukaryotes - 4 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Tr:AT5G01590.1"
FT                   /db_xref="GOA:Q7Y1W1"
FT                   /db_xref="InterPro:IPR025640"
FT                   /db_xref="InterPro:IPR037471"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7Y1W1"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EH911764.1,INSD:EL290968.1,INSD:EH931539.1,
FT                   INSD:EL218017.1,INSD:AV823461.1,INSD:ES143249.1,
FT                   INSD:EL092353.1,INSD:ES120172.1,INSD:EL007365.1,
FT                   INSD:EL256320.1,INSD:AV831658.1,INSD:EL181728.1,
FT                   INSD:EL056969.1,INSD:EL283437.1,INSD:AV557842.1,
FT                   INSD:EL101886.1,INSD:AV818493.1,INSD:EH926525.1,
FT                   INSD:AV813268.1,INSD:EL177726.1,INSD:AV561759.1,
FT                   INSD:DR276411.1,INSD:EL198314.1,INSD:EL202109.1,
FT                   INSD:DR382050.1,INSD:AV817315.1,INSD:ES131814.1,
FT                   INSD:EL135187.1,INSD:EL098402.1,INSD:DR276406.1,
FT                   INSD:BP828760.1,INSD:BP792244.1,INSD:EH990670.1,
FT                   INSD:DR276407.1,INSD:EL000021.1,INSD:EL302326.1,
FT                   INSD:EL151413.1,INSD:AV793234.1,INSD:DR276410.1,
FT                   INSD:DR276413.1,INSD:ES130922.1,INSD:ES049605.1,
FT                   INSD:BP828158.1,INSD:EL267266.1,INSD:DR276408.1,
FT                   INSD:DR276414.1,INSD:EL053299.1,INSD:EL968234.1,
FT                   INSD:DR295561.1,INSD:EL213418.1,INSD:DR276409.1,
FT                   INSD:BP793384.1,INSD:EL204742.1,INSD:EH879547.1,
FT                   INSD:EH958482.1,INSD:EL249641.1,INSD:EL336451.1,
FT                   INSD:BP808788.1,INSD:EL021518.1,INSD:DR359650.1,
FT                   INSD:BP669191.1,INSD:AV795594.1,INSD:AV804151.1,
FT                   INSD:EL307140.1,INSD:AV810236.1,INSD:ES136729.1,
FT                   INSD:DR276412.1,INSD:BP778634.1,INSD:BP788608.1,
FT                   INSD:BP792470.1,INSD:BP829643.1,INSD:EL041791.1,
FT                   INSD:ES030362.1,INSD:ES114159.1,INSD:EL261902.1,
FT                   INSD:AV794834.1,INSD:BP785319.1,INSD:EL050969.1,
FT                   INSD:AV784430.1,INSD:BP809697.1,INSD:ES161261.1,
FT                   INSD:AV788755.1,INSD:AV795289.1,INSD:AV794545.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY050767.1,INSD:BT008696.1"
FT                   /protein_id="AED90363.1"
FT                   /translation="MSSMNFNPFQNWFEKPPNPVPSINFVSLADSFFPKSQSPNFASIG
FT                   LPKFSKKSPKPETAGTDEPGPYKQIAEQFLWECENIPDYRHTPEVDKLLNEDPVFEKKE
FT                   NPSTEEIEAEQKWWESFRASPVVQFMTRAEEIADDMNKMELEDNDTPYRKEDKDYWRAI
FT                   PHVPGFDGRPMPRKAIKSKEESDDKFWDFMKQFLFGLWGFRQRPYPPGRPIDVAQAIGY
FT                   KRLEKRYYDFIMKTGGWWYKDRLGRSRGPCEIITLKTAYGAGIIDRDTFIWGEDMDEWA
FT                   PIHMVYGLEPAIATWEVRLGAAATAFLHKLQKGIPPWVPLKGREPKTYKQLQKEAIESK
FT                   KRDMAVLEANGGVWPGVRTPSHALFLWASGSELTTVLESDHMPNKFIPKQLRLELAKVI
FT                   PGLRPWEVISIEQAMDQISYGGEWYREPLGTYTTGPPYIREWNRSVMRLFRIFYNLSVR
FT                   VGQKLERTVPGFDTIMDKVQKDYDKRIARRMKRREEELREEDLKHYSGRTDEDEEEEEE
FT                   EDDDSNSKKD"
     MSSMNFNPFQ NWFEKPPNPV PSINFVSLAD SFFPKSQSPN FASIGLPKFS KKSPKPETAG        60
     TDEPGPYKQI AEQFLWECEN IPDYRHTPEV DKLLNEDPVF EKKENPSTEE IEAEQKWWES       120
     FRASPVVQFM TRAEEIADDM NKMELEDNDT PYRKEDKDYW RAIPHVPGFD GRPMPRKAIK       180
     SKEESDDKFW DFMKQFLFGL WGFRQRPYPP GRPIDVAQAI GYKRLEKRYY DFIMKTGGWW       240
     YKDRLGRSRG PCEIITLKTA YGAGIIDRDT FIWGEDMDEW APIHMVYGLE PAIATWEVRL       300
     GAAATAFLHK LQKGIPPWVP LKGREPKTYK QLQKEAIESK KRDMAVLEAN GGVWPGVRTP       360
     SHALFLWASG SELTTVLESD HMPNKFIPKQ LRLELAKVIP GLRPWEVISI EQAMDQISYG       420
     GEWYREPLGT YTTGPPYIRE WNRSVMRLFR IFYNLSVRVG QKLERTVPGF DTIMDKVQKD       480
     YDKRIARRMK RREEELREED LKHYSGRTDE DEEEEEEEDD DSNSKKD                     527
//

If you have problems or comments...

PBIL Back to PBIL home page