(data stored in ACNUC13479 zone)

EMBL: CP002688.PE111

CP002688.PE111       Location/Qualifiers
FT   CDS             join(231075..231161,231485..231539,231624..231994)
FT                   /codon_start=1
FT                   /gene_synonym="F7A7.130"
FT                   /gene_synonym="F7A7_130"
FT                   /locus_tag="AT5G01610"
FT                   /product="hypothetical protein (Protein of unknown
FT                   function, DUF538)"
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01610"
FT                   /db_xref="GOA:Q9M015"
FT                   /db_xref="InterPro:IPR007493"
FT                   /db_xref="InterPro:IPR036758"
FT                   /db_xref="PDB:1YDU"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9M015"
FT                   /protein_id="ANM68392.1"
FT                   /translation="MDQIFNKVGSYWLGQKANKQFDSVGNDLNSVSTSIEGGTKWLVNK
FT                   IKGKMQKPLPELLKEYDLPIGIFPGDATNYEFDEETKKLTVLIPSICEVGYKDSSVLKF
FT                   TTTVTGHLEKGKLTDVEGIKTKVMIWVKVTSISTDASKVYFTAGMKKSRSRDAYEVQRN
FT                   GLRVDKF"
     MDQIFNKVGS YWLGQKANKQ FDSVGNDLNS VSTSIEGGTK WLVNKIKGKM QKPLPELLKE        60
     YDLPIGIFPG DATNYEFDEE TKKLTVLIPS ICEVGYKDSS VLKFTTTVTG HLEKGKLTDV       120
     EGIKTKVMIW VKVTSISTDA SKVYFTAGMK KSRSRDAYEV QRNGLRVDKF                  170
//

If you have problems or comments...

PBIL Back to PBIL home page