(data stored in ACNUC13479 zone)

EMBL: CP002688.PE112

CP002688.PE112       Location/Qualifiers
FT   CDS             join(231075..231161,231485..231539,231624..231994)
FT                   /codon_start=1
FT                   /gene_synonym="F7A7.130"
FT                   /gene_synonym="F7A7_130"
FT                   /locus_tag="AT5G01610"
FT                   /product="hypothetical protein (Protein of unknown
FT                   function, DUF538)"
FT                   /note="Protein of unknown function, DUF538; CONTAINS
FT                   InterPro DOMAIN/s: Protein of unknown function DUF538
FT                   (InterPro:IPR007493); BEST Arabidopsis thaliana protein
FT                   match is: Protein of unknown function, DUF538
FT                   (TAIR:AT3G08890.2); Has 1807 Blast hits to 1807 proteins in
FT                   277 species: Archae - 0; Bacteria - 0; Metazoa - 736; Fungi
FT                   - 347; Plants - 385; Viruses - 0; Other Eukaryotes - 339
FT                   (source: NCBI BLink)."
FT                   /db_xref="GOA:Q9M015"
FT                   /db_xref="InterPro:IPR007493"
FT                   /db_xref="InterPro:IPR036758"
FT                   /db_xref="PDB:1YDU"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9M015"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:DR373420.1,INSD:BP562720.2,INSD:DR211904.1,
FT                   INSD:ES152253.1,INSD:DR211905.1,INSD:BP841998.1,
FT                   INSD:DR211906.1,INSD:AU226437.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BT011918.1,INSD:AY086139.1,INSD:AK227765.1,
FT                   INSD:BT004797.1"
FT                   /protein_id="AED90365.1"
FT                   /translation="MDQIFNKVGSYWLGQKANKQFDSVGNDLNSVSTSIEGGTKWLVNK
FT                   IKGKMQKPLPELLKEYDLPIGIFPGDATNYEFDEETKKLTVLIPSICEVGYKDSSVLKF
FT                   TTTVTGHLEKGKLTDVEGIKTKVMIWVKVTSISTDASKVYFTAGMKKSRSRDAYEVQRN
FT                   GLRVDKF"
     MDQIFNKVGS YWLGQKANKQ FDSVGNDLNS VSTSIEGGTK WLVNKIKGKM QKPLPELLKE        60
     YDLPIGIFPG DATNYEFDEE TKKLTVLIPS ICEVGYKDSS VLKFTTTVTG HLEKGKLTDV       120
     EGIKTKVMIW VKVTSISTDA SKVYFTAGMK KSRSRDAYEV QRNGLRVDKF                  170
//

If you have problems or comments...

PBIL Back to PBIL home page