(data stored in ACNUC13479 zone)

EMBL: CP002688.PE115

CP002688.PE115       Location/Qualifiers
FT   CDS             join(232882..233092,233207..233492,233691..233862,
FT                   233964..234160,234242..234394,234491..234821)
FT                   /codon_start=1
FT                   /gene="TBL35"
FT                   /gene_synonym="F7A7.140"
FT                   /gene_synonym="F7A7_140"
FT                   /gene_synonym="TRICHOME BIREFRINGENCE-LIKE 35"
FT                   /locus_tag="AT5G01620"
FT                   /product="TRICHOME BIREFRINGENCE-LIKE 35"
FT                   /note="TRICHOME BIREFRINGENCE-LIKE 35; LOCATED IN:
FT                   endomembrane system; EXPRESSED IN: 23 plant structures;
FT                   EXPRESSED DURING: 14 growth stages; CONTAINS InterPro
FT                   DOMAIN/s: Protein of unknown function DUF231, plant
FT                   (InterPro:IPR004253); BEST Arabidopsis thaliana protein
FT                   match is: TRICHOME BIREFRINGENCE-LIKE 34
FT                   (TAIR:AT2G38320.1); Has 1369 Blast hits to 1347 proteins in
FT                   38 species: Archae - 0; Bacteria - 0; Metazoa - 25; Fungi -
FT                   0; Plants - 1344; Viruses - 0; Other Eukaryotes - 0
FT                   (source: NCBI BLink)."
FT                   /db_xref="GOA:Q8RXQ1"
FT                   /db_xref="InterPro:IPR025846"
FT                   /db_xref="InterPro:IPR026057"
FT                   /db_xref="InterPro:IPR029962"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RXQ1"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:AV785707.1,INSD:CF772985.1,INSD:AV441710.1,
FT                   INSD:ES123425.1,INSD:DR379270.1,INSD:ES003552.1,
FT                   INSD:EH852298.1,INSD:DR378727.1,INSD:ES181936.1,
FT                   INSD:EL146039.1,INSD:AU227536.1,INSD:AV543066.1,
FT                   INSD:ES066611.1,INSD:EL131616.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY117243.1,INSD:BX831772.1,INSD:AY080736.1"
FT                   /protein_id="AED90367.1"
FT                   /translation="MSQRWSRKKSRLPLAGLLFILVVTFMILFNERSIQQIHHHAASHT
FT                   QNLREPSTFDFVKPNVPRINYLGAHEVLDRFSKCNSTKEYSGKKIGWVDPFEDHPGQVT
FT                   KEEQKCDVFSGKWVFDNSSSYPLHKESQCPYMSDQLACQKHGRKDLEYQHWRWQPHACN
FT                   LKRWNAIEMWEKLRGKRLMFVGDSLNRGQWISMVCLLQSVIPRDKQSMSPNAHLTIFRA
FT                   EDYNATVEFLWAPLLVESNSDDPVNHRLSERIIRPDSVLKHASKWQHADILIFNTYLWW
FT                   RQDSVKLRWSSEEKGSCEEVKSAEGMEMAMDSWGDWVANNVDPNKKRVFFVTMSPTHQW
FT                   SREWNPGSEGNCYGEKKPIEEESYWGSGSDIPTMRMVKRVLERLGPKVSVINITQLSEY
FT                   RKDGHPSVYRKFWEPLNEDRLKNPASYSDCTHWCVPGVPDVWNQLLFHFL"
     MSQRWSRKKS RLPLAGLLFI LVVTFMILFN ERSIQQIHHH AASHTQNLRE PSTFDFVKPN        60
     VPRINYLGAH EVLDRFSKCN STKEYSGKKI GWVDPFEDHP GQVTKEEQKC DVFSGKWVFD       120
     NSSSYPLHKE SQCPYMSDQL ACQKHGRKDL EYQHWRWQPH ACNLKRWNAI EMWEKLRGKR       180
     LMFVGDSLNR GQWISMVCLL QSVIPRDKQS MSPNAHLTIF RAEDYNATVE FLWAPLLVES       240
     NSDDPVNHRL SERIIRPDSV LKHASKWQHA DILIFNTYLW WRQDSVKLRW SSEEKGSCEE       300
     VKSAEGMEMA MDSWGDWVAN NVDPNKKRVF FVTMSPTHQW SREWNPGSEG NCYGEKKPIE       360
     EESYWGSGSD IPTMRMVKRV LERLGPKVSV INITQLSEYR KDGHPSVYRK FWEPLNEDRL       420
     KNPASYSDCT HWCVPGVPDV WNQLLFHFL                                         449
//

If you have problems or comments...

PBIL Back to PBIL home page