(data stored in ACNUC13479 zone)

EMBL: CP002688.PE118

CP002688.PE118       Location/Qualifiers
FT   CDS             complement(join(242734..242769,243248..243448,
FT                   243923..244033))
FT                   /codon_start=1
FT                   /gene_synonym="F7A7.170"
FT                   /gene_synonym="F7A7_170"
FT                   /locus_tag="AT5G01650"
FT                   /product="Tautomerase/MIF superfamily protein"
FT                   /note="Tautomerase/MIF superfamily protein; FUNCTIONS IN:
FT                   molecular_function unknown; INVOLVED IN: inflammatory
FT                   response, response to other organism; LOCATED IN:
FT                   chloroplast; EXPRESSED IN: 23 plant structures; EXPRESSED
FT                   DURING: 13 growth stages; CONTAINS InterPro DOMAIN/s:
FT                   Tautomerase (InterPro:IPR014347), Macrophage migration
FT                   inhibitory factor (InterPro:IPR001398); BEST Arabidopsis
FT                   thaliana protein match is: Tautomerase/MIF superfamily
FT                   protein (TAIR:AT5G57170.1); Has 1807 Blast hits to 1807
FT                   proteins in 277 species: Archae - 0; Bacteria - 0; Metazoa
FT                   - 736; Fungi - 347; Plants - 385; Viruses - 0; Other
FT                   Eukaryotes - 339 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01650"
FT                   /db_xref="InterPro:IPR001398"
FT                   /db_xref="InterPro:IPR014347"
FT                   /db_xref="UniProtKB/TrEMBL:Q9M011"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EL975524.1,INSD:EL977901.1,INSD:EL306996.1,
FT                   INSD:EH885476.1,INSD:BP851259.1,INSD:AI996103.1,
FT                   INSD:EG503170.1,INSD:DR211124.1,INSD:EL310221.1,
FT                   INSD:EL995482.1,INSD:AV823736.2,INSD:EH916322.1,
FT                   INSD:EG481199.1,INSD:EH941550.1,INSD:AA713318.1,
FT                   INSD:ES213204.1,INSD:BP868249.1,INSD:DR211123.1,
FT                   INSD:BP852291.1,INSD:ES068836.1,INSD:BP588414.1,
FT                   INSD:DR211122.1,INSD:EL994591.1,INSD:EL291872.1,
FT                   INSD:EL078851.1,INSD:BP802073.1,INSD:DR211112.1,
FT                   INSD:ES042723.1,INSD:EL219072.1,INSD:EG459589.1,
FT                   INSD:ES216094.1,INSD:EL267247.1,INSD:ES146690.1,
FT                   INSD:BE038533.1,INSD:ES002070.1,INSD:DR211115.1,
FT                   INSD:EL978997.1,INSD:EH928446.1,INSD:ES169934.1,
FT                   INSD:EL295164.1,INSD:EL130133.1,INSD:DR211120.1,
FT                   INSD:ES176124.1,INSD:EG472385.1,INSD:EG459588.1,
FT                   INSD:DR211107.1,INSD:AV532350.1,INSD:EL990632.1,
FT                   INSD:EG481198.1,INSD:EH991369.1,INSD:ES196376.1,
FT                   INSD:ES006297.1,INSD:EL986992.1,INSD:EL103452.1,
FT                   INSD:ES161950.1,INSD:EH869973.1,INSD:EL029951.1,
FT                   INSD:DR211116.1,INSD:ES003119.1,INSD:DR261297.1,
FT                   INSD:EL002917.1,INSD:ES021924.1,INSD:ES187411.1,
FT                   INSD:EL231807.1,INSD:EH980638.1,INSD:EL339329.1,
FT                   INSD:AV820539.1,INSD:EG472386.1,INSD:ES162861.1,
FT                   INSD:EL196164.1,INSD:DR211118.1,INSD:DR211111.1,
FT                   INSD:EL971339.1,INSD:DR211114.1,INSD:DR211106.1,
FT                   INSD:DR211117.1,INSD:AV534735.1,INSD:EG503182.1,
FT                   INSD:BP844092.1,INSD:DR211125.1,INSD:AV789394.1,
FT                   INSD:EH993777.1,INSD:DR211126.1,INSD:DR211119.1,
FT                   INSD:EL109927.1,INSD:EL136751.1,INSD:EG503171.1,
FT                   INSD:DR211110.1,INSD:EL224701.1,INSD:DR370544.1,
FT                   INSD:DR211113.1,INSD:DR211105.1,INSD:EL185350.1,
FT                   INSD:BP591041.1,INSD:EL982202.1,INSD:ES019282.1,
FT                   INSD:ES002268.1,INSD:DR211108.1,INSD:DR211121.1,
FT                   INSD:EH900018.1,INSD:F14405.1,INSD:DR378529.1,
FT                   INSD:ES110201.1,INSD:EL196546.1,INSD:ES203016.1,
FT                   INSD:EL112857.1,INSD:ES064280.1,INSD:ES068071.1,
FT                   INSD:ES023022.1,INSD:DR211109.1,INSD:EG503181.1,
FT                   INSD:DR378149.1,INSD:ES118764.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY062859.1,INSD:AY081575.1,INSD:BX833438.1,
FT                   INSD:BX830182.1,INSD:X58827.1"
FT                   /protein_id="AED90371.1"
FT                   /translation="MPCLNLSTNVNLDGVDTSSILSEASSTVAKIIGKPENYVMIVLKG
FT                   SVPMSFGGTEDPAAYGELVSIGGLNADVNKKLSAAVSAILETKLSVPKSRFFLKFYDTK
FT                   GSFFGWNGATL"
     MPCLNLSTNV NLDGVDTSSI LSEASSTVAK IIGKPENYVM IVLKGSVPMS FGGTEDPAAY        60
     GELVSIGGLN ADVNKKLSAA VSAILETKLS VPKSRFFLKF YDTKGSFFGW NGATL            115
//

If you have problems or comments...

PBIL Back to PBIL home page