(data stored in ACNUC13479 zone)

EMBL: CP002688.PE119

CP002688.PE119       Location/Qualifiers
FT   CDS             complement(join(243067..243123,243248..243448,
FT                   243923..244033))
FT                   /codon_start=1
FT                   /gene_synonym="F7A7.170"
FT                   /gene_synonym="F7A7_170"
FT                   /locus_tag="AT5G01650"
FT                   /product="Tautomerase/MIF superfamily protein"
FT                   /db_xref="GOA:F4K9G5"
FT                   /db_xref="InterPro:IPR001398"
FT                   /db_xref="InterPro:IPR014347"
FT                   /db_xref="UniProtKB/TrEMBL:F4K9G5"
FT                   /protein_id="ANM68179.1"
FT                   /translation="MPCLNLSTNVNLDGVDTSSILSEASSTVAKIIGKPENYVMIVLKG
FT                   SVPMSFGGTEDPAAYGELVSIGGLNADVNKKLSAAVSAILETKLSVPKSRFFLKFYDTK
FT                   DHQSQEYAQCLHALHQHY"
     MPCLNLSTNV NLDGVDTSSI LSEASSTVAK IIGKPENYVM IVLKGSVPMS FGGTEDPAAY        60
     GELVSIGGLN ADVNKKLSAA VSAILETKLS VPKSRFFLKF YDTKDHQSQE YAQCLHALHQ       120
     HY                                                                      122
//

If you have problems or comments...

PBIL Back to PBIL home page