(data stored in ACNUC13479 zone)

EMBL: CP002688.PE12

CP002688.PE12        Location/Qualifiers
FT   CDS             join(10638..12665,12797..13003)
FT                   /codon_start=1
FT                   /gene_synonym="F7J8.10"
FT                   /gene_synonym="F7J8_10"
FT                   /locus_tag="AT5G01030"
FT                   /product="enolase, putative (DUF3527)"
FT                   /note="Protein of unknown function (DUF3527); FUNCTIONS IN:
FT                   molecular_function unknown; INVOLVED IN: biological_process
FT                   unknown; LOCATED IN: cellular_component unknown; EXPRESSED
FT                   IN: 24 plant structures; EXPRESSED DURING: 13 growth
FT                   stages; CONTAINS InterPro DOMAIN/s: Protein of unknown
FT                   function DUF3527 (InterPro:IPR021916); BEST Arabidopsis
FT                   thaliana protein match is: Protein of unknown function
FT                   (DUF3527) (TAIR:AT2G37930.1); Has 286 Blast hits to 251
FT                   proteins in 78 species: Archae - 0; Bacteria - 81; Metazoa
FT                   - 28; Fungi - 27; Plants - 128; Viruses - 0; Other
FT                   Eukaryotes - 22 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01030"
FT                   /db_xref="GOA:Q9LFD3"
FT                   /db_xref="InterPro:IPR021916"
FT                   /db_xref="UniProtKB/TrEMBL:Q9LFD3"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:BP628641.1,INSD:DR366778.1,INSD:AV528484.1,
FT                   INSD:AV539116.1,INSD:EL096876.1,INSD:EG510072.1,
FT                   INSD:DR366772.1,INSD:BG459331.1,INSD:EG510074.1,
FT                   INSD:DR366777.1,INSD:DR366773.1,INSD:AV522932.1,
FT                   INSD:BP605912.1,INSD:DR366774.1,INSD:AV547029.1,
FT                   INSD:BP616398.1,INSD:AV784392.1,INSD:EG507809.1,
FT                   INSD:DR366775.1,INSD:DR366776.1,INSD:AV551489.1,
FT                   INSD:EG507815.1,INSD:F14175.1,INSD:BP616094.1,
FT                   INSD:EG510066.1,INSD:AV548054.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BX831094.1,INSD:BT002362.1"
FT                   /protein_id="AED90290.1"
FT                   /translation="MAEKEGKASGTDNDNRVKTKRSSHSRRKECVNKSLEHNDELVKYM
FT                   SKLPGYLQRIERGEESVHQSNVLNVGVLDWESLQRWKHGRAKGGEISGRSERKVSTIAT
FT                   TSTSGVVVPNDSANRCKIDDQVHTCSNLGKVKASRDLQYSLEPQLASRDSLNKQEIATC
FT                   SYKSSGRDHKGVEPRKSRRTHSNRESTTGLSSEMGNSAGSLFRDKETQKRAGEIHAKEA
FT                   RERAKECVEKLDGDEKIIGDSEAGLTSEKQEFSNIFLLRSRKQSRSTLSGEPQISREVN
FT                   RSLDFSDGINSSFGLRSQIPSSCPLSFDLERDSEDMMLPLGTDLSGKRGGKRHSKTTSR
FT                   IFDREFPEDESRKERHPSPSKRFSFSFGRLSRNFSLKDISAGQPLSSSEDTIMSGSMRF
FT                   DGSVCPSQSSNPENQNTHCRSRVSPLRRFLDPLLKPKASESVLPSKARSSSSNPKPITN
FT                   SNVPLQDEKKQDASRTLAIFQLTIRNGIPLFQFVVDDNSSSSRSILGATMKSSDSSFKD
FT                   DSVQYCTFYSVNEVKKKKSGSWLIHGHREKHCGFVYNIIGQMQLGNSMSVDISEQKSLI
FT                   TESVLFDESEQVKGRKEVAAVVIKKKPVEGSYTSFEETSVIIPGGVHSFPEKGAPSPLI
FT                   SRWRSGGLCDCGGWDVGCKLHVLSNKTVLHKFNQSFTLFDQEVSEQDSSPALAMTELKT
FT                   GIYRVEFGSFVSPLQAFFVCVTVLTCASKAKTTGKSSSPMAPPLSPVGRV"
     MAEKEGKASG TDNDNRVKTK RSSHSRRKEC VNKSLEHNDE LVKYMSKLPG YLQRIERGEE        60
     SVHQSNVLNV GVLDWESLQR WKHGRAKGGE ISGRSERKVS TIATTSTSGV VVPNDSANRC       120
     KIDDQVHTCS NLGKVKASRD LQYSLEPQLA SRDSLNKQEI ATCSYKSSGR DHKGVEPRKS       180
     RRTHSNREST TGLSSEMGNS AGSLFRDKET QKRAGEIHAK EARERAKECV EKLDGDEKII       240
     GDSEAGLTSE KQEFSNIFLL RSRKQSRSTL SGEPQISREV NRSLDFSDGI NSSFGLRSQI       300
     PSSCPLSFDL ERDSEDMMLP LGTDLSGKRG GKRHSKTTSR IFDREFPEDE SRKERHPSPS       360
     KRFSFSFGRL SRNFSLKDIS AGQPLSSSED TIMSGSMRFD GSVCPSQSSN PENQNTHCRS       420
     RVSPLRRFLD PLLKPKASES VLPSKARSSS SNPKPITNSN VPLQDEKKQD ASRTLAIFQL       480
     TIRNGIPLFQ FVVDDNSSSS RSILGATMKS SDSSFKDDSV QYCTFYSVNE VKKKKSGSWL       540
     IHGHREKHCG FVYNIIGQMQ LGNSMSVDIS EQKSLITESV LFDESEQVKG RKEVAAVVIK       600
     KKPVEGSYTS FEETSVIIPG GVHSFPEKGA PSPLISRWRS GGLCDCGGWD VGCKLHVLSN       660
     KTVLHKFNQS FTLFDQEVSE QDSSPALAMT ELKTGIYRVE FGSFVSPLQA FFVCVTVLTC       720
     ASKAKTTGKS SSPMAPPLSP VGRV                                              744
//

If you have problems or comments...

PBIL Back to PBIL home page