(data stored in ACNUC13479 zone)

EMBL: CP002688.PE120

CP002688.PE120       Location/Qualifiers
FT   CDS             complement(join(243067..243123,243248..243448,
FT                   243923..244033))
FT                   /codon_start=1
FT                   /gene_synonym="F7A7.170"
FT                   /gene_synonym="F7A7_170"
FT                   /locus_tag="AT5G01650"
FT                   /product="Tautomerase/MIF superfamily protein"
FT                   /note="Tautomerase/MIF superfamily protein; FUNCTIONS IN:
FT                   molecular_function unknown; INVOLVED IN: inflammatory
FT                   response, response to other organism; EXPRESSED IN: 23
FT                   plant structures; EXPRESSED DURING: 13 growth stages;
FT                   CONTAINS InterPro DOMAIN/s: Tautomerase
FT                   (InterPro:IPR014347), Macrophage migration inhibitory
FT                   factor (InterPro:IPR001398); BEST Arabidopsis thaliana
FT                   protein match is: Tautomerase/MIF superfamily protein
FT                   (TAIR:AT5G57170.2); Has 820 Blast hits to 820 proteins in
FT                   207 species: Archae - 0; Bacteria - 141; Metazoa - 384;
FT                   Fungi - 26; Plants - 141; Viruses - 0; Other Eukaryotes -
FT                   128 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01650"
FT                   /db_xref="EnsemblGenomes-Tr:AT5G01650.2"
FT                   /db_xref="GOA:F4K9G5"
FT                   /db_xref="InterPro:IPR001398"
FT                   /db_xref="InterPro:IPR014347"
FT                   /db_xref="UniProtKB/TrEMBL:F4K9G5"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EL975524.1,INSD:EL977901.1,INSD:ES187411.1,
FT                   INSD:EL231807.1,INSD:EH885476.1,INSD:EH980638.1,
FT                   INSD:EL339329.1,INSD:EG503170.1,INSD:EL310221.1,
FT                   INSD:EL995482.1,INSD:EL196164.1,INSD:EH916322.1,
FT                   INSD:EL971339.1,INSD:DR211114.1,INSD:DR211106.1,
FT                   INSD:AA713318.1,INSD:EG481199.1,INSD:DR211123.1,
FT                   INSD:ES213204.1,INSD:ES068836.1,INSD:EG503182.1,
FT                   INSD:EL994591.1,INSD:EL291872.1,INSD:EL078851.1,
FT                   INSD:EH993777.1,INSD:ES042723.1,INSD:EL219072.1,
FT                   INSD:EL109927.1,INSD:EL136751.1,INSD:EG503171.1,
FT                   INSD:ES216094.1,INSD:ES146690.1,INSD:ES002070.1,
FT                   INSD:EL978997.1,INSD:EH928446.1,INSD:EL185350.1,
FT                   INSD:ES169934.1,INSD:EL295164.1,INSD:EL982202.1,
FT                   INSD:EL130133.1,INSD:ES019282.1,INSD:ES002268.1,
FT                   INSD:EG459588.1,INSD:ES176124.1,INSD:EH900018.1,
FT                   INSD:DR211107.1,INSD:EL990632.1,INSD:EG481198.1,
FT                   INSD:ES110201.1,INSD:EL196546.1,INSD:ES203016.1,
FT                   INSD:EL112857.1,INSD:EH991369.1,INSD:ES064280.1,
FT                   INSD:ES196376.1,INSD:ES006297.1,INSD:EL986992.1,
FT                   INSD:EL103452.1,INSD:ES161950.1,INSD:EL029951.1,
FT                   INSD:EG503181.1,INSD:ES003119.1,INSD:ES021924.1,
FT                   INSD:EL002917.1,INSD:ES118764.1"
FT                   /protein_id="AED90372.1"
FT                   /translation="MPCLNLSTNVNLDGVDTSSILSEASSTVAKIIGKPENYVMIVLKG
FT                   SVPMSFGGTEDPAAYGELVSIGGLNADVNKKLSAAVSAILETKLSVPKSRFFLKFYDTK
FT                   DHQSQEYAQCLHALHQHY"
     MPCLNLSTNV NLDGVDTSSI LSEASSTVAK IIGKPENYVM IVLKGSVPMS FGGTEDPAAY        60
     GELVSIGGLN ADVNKKLSAA VSAILETKLS VPKSRFFLKF YDTKDHQSQE YAQCLHALHQ       120
     HY                                                                      122
//

If you have problems or comments...

PBIL Back to PBIL home page