(data stored in ACNUC13479 zone)

EMBL: CP002688.PE124

CP002688.PE124       Location/Qualifiers
FT   CDS             complement(join(245512..245747,246111..246450,
FT                   246687..246764,247203..247796,247951..248132,
FT                   248325..248442))
FT                   /codon_start=1
FT                   /gene_synonym="F7A7.180"
FT                   /gene_synonym="F7A7_180"
FT                   /locus_tag="AT5G01660"
FT                   /product="influenza virus NS1A-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01660"
FT                   /db_xref="InterPro:IPR006652"
FT                   /db_xref="InterPro:IPR013989"
FT                   /db_xref="InterPro:IPR015915"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1P8BDS4"
FT                   /protein_id="ANM69768.1"
FT                   /translation="MAQRRGKFSFRNLTKSQLGGVVFGCTKNTIKECMSKQLFGLPSNH
FT                   YPYVQKIDIGLPLFLFNYSDRTLHGIFEAAGCGQLNFDPYGWTSDGSERTSYPAQVPIS
FT                   VRLQCEPLSEEKFKPAIADNYYSSHHFWFELDHFQTRKLTCLLTSFAVKPKPPMNTPNT
FT                   RQIFRLISSSEKKENSDEVKPSENEPVGSLEVSLSSGGESDSSAAASHPGFSENHPDVQ
FT                   NPKQIDKDHVLEKLKDLVFSHDEHGDNSLTETVEQANIPTCKNLEDRDTLEEETCSEGK
FT                   IDGSCLVSSPLPHTISQLMHEVKELRACGLENSTKICYLEEKLDKAHKEIYQLTERCNM
FT                   LESISGPLITKAGGSDLEIHSPDDTSLDPTEAILLLGGFDKDSETWLSSVQSYFPSRNV
FT                   VKAHSSMSCIRSNASVAKLDGKIYVFGGDDGGRGWTNSAESFNQTDGQWSLCPPLNERK
FT                   GSLGGATLDGKIFAIGGGNGMVSFSDVEMLDPDIGRWIRTRSMGQEVNVLLYSHDIW"
     MAQRRGKFSF RNLTKSQLGG VVFGCTKNTI KECMSKQLFG LPSNHYPYVQ KIDIGLPLFL        60
     FNYSDRTLHG IFEAAGCGQL NFDPYGWTSD GSERTSYPAQ VPISVRLQCE PLSEEKFKPA       120
     IADNYYSSHH FWFELDHFQT RKLTCLLTSF AVKPKPPMNT PNTRQIFRLI SSSEKKENSD       180
     EVKPSENEPV GSLEVSLSSG GESDSSAAAS HPGFSENHPD VQNPKQIDKD HVLEKLKDLV       240
     FSHDEHGDNS LTETVEQANI PTCKNLEDRD TLEEETCSEG KIDGSCLVSS PLPHTISQLM       300
     HEVKELRACG LENSTKICYL EEKLDKAHKE IYQLTERCNM LESISGPLIT KAGGSDLEIH       360
     SPDDTSLDPT EAILLLGGFD KDSETWLSSV QSYFPSRNVV KAHSSMSCIR SNASVAKLDG       420
     KIYVFGGDDG GRGWTNSAES FNQTDGQWSL CPPLNERKGS LGGATLDGKI FAIGGGNGMV       480
     SFSDVEMLDP DIGRWIRTRS MGQEVNVLLY SHDIW                                  515
//

If you have problems or comments...

PBIL Back to PBIL home page