(data stored in ACNUC13479 zone)

EMBL: CP002688.PE125

CP002688.PE125       Location/Qualifiers
FT   CDS             join(252000..252143,252298..252348,252448..252690,
FT                   252762..252968,253043..253114,253186..253428,
FT                   253767..253856)
FT                   /codon_start=1
FT                   /gene_synonym="F7A7.190"
FT                   /gene_synonym="F7A7_190"
FT                   /locus_tag="AT5G01670"
FT                   /product="NAD(P)-linked oxidoreductase superfamily protein"
FT                   /note="NAD(P)-linked oxidoreductase superfamily protein;
FT                   FUNCTIONS IN: oxidoreductase activity; INVOLVED IN:
FT                   oxidation reduction; EXPRESSED IN: 18 plant structures;
FT                   EXPRESSED DURING: 11 growth stages; CONTAINS InterPro
FT                   DOMAIN/s: Aldo/keto reductase (InterPro:IPR001395),
FT                   Aldo/keto reductase subgroup (InterPro:IPR020471),
FT                   Aldo/keto reductase, conserved site (InterPro:IPR018170);
FT                   BEST Arabidopsis thaliana protein match is: NAD(P)-linked
FT                   oxidoreductase superfamily protein (TAIR:AT2G37770.2); Has
FT                   16960 Blast hits to 16922 proteins in 2239 species: Archae
FT                   - 315; Bacteria - 10569; Metazoa - 1835; Fungi - 1554;
FT                   Plants - 1108; Viruses - 0; Other Eukaryotes - 1579
FT                   (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01670"
FT                   /db_xref="EnsemblGenomes-Tr:AT5G01670.2"
FT                   /db_xref="GOA:F4K9G7"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:F4K9G7"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:BP623788.1,INSD:EL065720.1,INSD:BE524891.1,
FT                   INSD:BE522549.1,INSD:BP604014.1,INSD:BP657803.1,
FT                   INSD:BE529419.1,INSD:BP642126.1,INSD:BP646310.1,
FT                   INSD:BP651268.1,INSD:BE528959.1,INSD:BE530268.1,
FT                   INSD:AU230104.1,INSD:BP828621.1"
FT                   /protein_id="AED90375.1"
FT                   /translation="MAHATFTSEGQNMESFRLLSGHKIPAVGLGTWRSGSQAAHAVVTA
FT                   IVEGGYRHIDTAWEYGDQREVGQGIKRAMHAGLERRDLFVTSKLWYTLILRKMINLSSP
FT                   LMNVLVGTCLNKRCTELSPERVRPALQNTLKELQLEYLDLYLIHWPIRLREGASKPPKA
FT                   GDVLDFDMEGVWREMENLSKDSLVRNIGVCNFTVTKLNKLLGFAELIPAVCQMEMHPGW
FT                   RNDRILEFCKKNEIHVTAYSPLGSQEGGRDLIHDQTVDRIAKKLNKTPGQILVKWGLQR
FT                   GTSVIPKSLNPERIKENIKVFDWVIPEQDFQALNSITDQKRVIDGEDLFVNKTEGPFRS
FT                   VADLWDHED"
     MAHATFTSEG QNMESFRLLS GHKIPAVGLG TWRSGSQAAH AVVTAIVEGG YRHIDTAWEY        60
     GDQREVGQGI KRAMHAGLER RDLFVTSKLW YTLILRKMIN LSSPLMNVLV GTCLNKRCTE       120
     LSPERVRPAL QNTLKELQLE YLDLYLIHWP IRLREGASKP PKAGDVLDFD MEGVWREMEN       180
     LSKDSLVRNI GVCNFTVTKL NKLLGFAELI PAVCQMEMHP GWRNDRILEF CKKNEIHVTA       240
     YSPLGSQEGG RDLIHDQTVD RIAKKLNKTP GQILVKWGLQ RGTSVIPKSL NPERIKENIK       300
     VFDWVIPEQD FQALNSITDQ KRVIDGEDLF VNKTEGPFRS VADLWDHED                   349
//

If you have problems or comments...

PBIL Back to PBIL home page