(data stored in ACNUC13479 zone)

EMBL: CP002688.PE126

CP002688.PE126       Location/Qualifiers
FT   CDS             join(252000..252143,252298..252348,252448..252521,
FT                   252603..252690,252762..252968,253043..253114,
FT                   253186..253428,253767..253856)
FT                   /codon_start=1
FT                   /gene_synonym="F7A7.190"
FT                   /gene_synonym="F7A7_190"
FT                   /locus_tag="AT5G01670"
FT                   /product="NAD(P)-linked oxidoreductase superfamily protein"
FT                   /note="NAD(P)-linked oxidoreductase superfamily protein;
FT                   FUNCTIONS IN: oxidoreductase activity; INVOLVED IN:
FT                   oxidation reduction; EXPRESSED IN: 18 plant structures;
FT                   EXPRESSED DURING: 11 growth stages; CONTAINS InterPro
FT                   DOMAIN/s: Aldo/keto reductase (InterPro:IPR001395),
FT                   Aldo/keto reductase subgroup (InterPro:IPR020471),
FT                   Aldo/keto reductase, conserved site (InterPro:IPR018170);
FT                   BEST Arabidopsis thaliana protein match is: NAD(P)-linked
FT                   oxidoreductase superfamily protein (TAIR:AT2G37770.2); Has
FT                   19068 Blast hits to 19040 proteins in 2308 species: Archae
FT                   - 339; Bacteria - 12194; Metazoa - 2060; Fungi - 1600;
FT                   Plants - 1171; Viruses - 0; Other Eukaryotes - 1704
FT                   (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01670"
FT                   /db_xref="GOA:Q8GXW0"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q8GXW0"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:BP623788.1,INSD:EL065720.1,INSD:BP836767.1,
FT                   INSD:CK121221.1,INSD:BP604014.1,INSD:BE529419.1,
FT                   INSD:BP642126.1,INSD:BE520928.1,INSD:BE525213.1,
FT                   INSD:BP651268.1,INSD:BE524761.1,INSD:BE526293.1,
FT                   INSD:BE522549.1,INSD:BP830409.1,INSD:BP657803.1,
FT                   INSD:AU238858.1,INSD:BP646310.1,INSD:BP832562.1,
FT                   INSD:BP834102.1,INSD:BE528959.1,INSD:BE520929.1,
FT                   INSD:BE530268.1,INSD:BE520689.1,INSD:BP824263.1,
FT                   INSD:BP830821.1,INSD:AU230104.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BX832789.1,INSD:AK118010.1,INSD:BT030096.1"
FT                   /protein_id="AED90374.1"
FT                   /translation="MAHATFTSEGQNMESFRLLSGHKIPAVGLGTWRSGSQAAHAVVTA
FT                   IVEGGYRHIDTAWEYGDQREVGQGIKRAMHAGLERRDLFVTSKLWCTELSPERVRPALQ
FT                   NTLKELQLEYLDLYLIHWPIRLREGASKPPKAGDVLDFDMEGVWREMENLSKDSLVRNI
FT                   GVCNFTVTKLNKLLGFAELIPAVCQMEMHPGWRNDRILEFCKKNEIHVTAYSPLGSQEG
FT                   GRDLIHDQTVDRIAKKLNKTPGQILVKWGLQRGTSVIPKSLNPERIKENIKVFDWVIPE
FT                   QDFQALNSITDQKRVIDGEDLFVNKTEGPFRSVADLWDHED"
     MAHATFTSEG QNMESFRLLS GHKIPAVGLG TWRSGSQAAH AVVTAIVEGG YRHIDTAWEY        60
     GDQREVGQGI KRAMHAGLER RDLFVTSKLW CTELSPERVR PALQNTLKEL QLEYLDLYLI       120
     HWPIRLREGA SKPPKAGDVL DFDMEGVWRE MENLSKDSLV RNIGVCNFTV TKLNKLLGFA       180
     ELIPAVCQME MHPGWRNDRI LEFCKKNEIH VTAYSPLGSQ EGGRDLIHDQ TVDRIAKKLN       240
     KTPGQILVKW GLQRGTSVIP KSLNPERIKE NIKVFDWVIP EQDFQALNSI TDQKRVIDGE       300
     DLFVNKTEGP FRSVADLWDH ED                                                322
//

If you have problems or comments...

PBIL Back to PBIL home page