(data stored in ACNUC13479 zone)

EMBL: CP002688.PE129

CP002688.PE129       Location/Qualifiers
FT   CDS             complement(join(260848..261147,261229..261452,
FT                   261583..261697,261785..262090,262289..262492))
FT                   /codon_start=1
FT                   /gene_synonym="F7A7.220"
FT                   /gene_synonym="F7A7_220"
FT                   /locus_tag="AT5G01700"
FT                   /product="Protein phosphatase 2C family protein"
FT                   /note="Protein phosphatase 2C family protein; FUNCTIONS IN:
FT                   protein serine/threonine phosphatase activity, catalytic
FT                   activity; INVOLVED IN: biological_process unknown; LOCATED
FT                   IN: cellular_component unknown; EXPRESSED IN: 9 plant
FT                   structures; EXPRESSED DURING: L mature pollen stage, M
FT                   germinated pollen stage, 4 anthesis, petal differentiation
FT                   and expansion stage; CONTAINS InterPro DOMAIN/s: Protein
FT                   phosphatase 2C-related (InterPro:IPR001932), Protein
FT                   phosphatase 2C (InterPro:IPR015655), Protein phosphatase
FT                   2C, N-terminal (InterPro:IPR014045); BEST Arabidopsis
FT                   thaliana protein match is: Protein phosphatase 2C family
FT                   protein (TAIR:AT5G36250.1); Has 5499 Blast hits to 5498
FT                   proteins in 290 species: Archae - 0; Bacteria - 8; Metazoa
FT                   - 1364; Fungi - 621; Plants - 2393; Viruses - 5; Other
FT                   Eukaryotes - 1108 (source: NCBI BLink)."
FT                   /db_xref="GOA:Q6NKS1"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6NKS1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BT011618.1,INSD:BT012622.1"
FT                   /protein_id="AED90379.1"
FT                   /translation="MGVCCSKGTGIIVEHGADDGNECGDGEAEVRDTNDGAVVRTRGSS
FT                   KHVSMSIKQGKKGINQDAMTVWENFGGEEDTIFCGVFDGHGPMGHKISRHVCENLPSRV
FT                   HSKIRSSKSAGDENIENNSSQSQEELFREFEDILVTFFKQIDSELGLDSPYDSFCSGTT
FT                   AVTVFKQADCLVIANLGHSRAVLGTRSKNSFKAVQLTVDLKPCVQREAERIVSCKGRVF
FT                   AMEEEPDVYRVWMPDDDCPGLAMSRAFGDFCLKDYGLVCIPDVFCRKVSREDEFVVLAT
FT                   DGIWDVLSNEEVVKVVGSCKDRSVAAEMLVQRAARTWRTKFPASKADDCAVVVLYLNHR
FT                   PYPREGNVSRAISTISWRSNKSNNECYGAAPLSPLGLSQRVS"
     MGVCCSKGTG IIVEHGADDG NECGDGEAEV RDTNDGAVVR TRGSSKHVSM SIKQGKKGIN        60
     QDAMTVWENF GGEEDTIFCG VFDGHGPMGH KISRHVCENL PSRVHSKIRS SKSAGDENIE       120
     NNSSQSQEEL FREFEDILVT FFKQIDSELG LDSPYDSFCS GTTAVTVFKQ ADCLVIANLG       180
     HSRAVLGTRS KNSFKAVQLT VDLKPCVQRE AERIVSCKGR VFAMEEEPDV YRVWMPDDDC       240
     PGLAMSRAFG DFCLKDYGLV CIPDVFCRKV SREDEFVVLA TDGIWDVLSN EEVVKVVGSC       300
     KDRSVAAEML VQRAARTWRT KFPASKADDC AVVVLYLNHR PYPREGNVSR AISTISWRSN       360
     KSNNECYGAA PLSPLGLSQR VS                                                382
//

If you have problems or comments...

PBIL Back to PBIL home page