(data stored in ACNUC13479 zone)

EMBL: CP002688.PE130

CP002688.PE130       Location/Qualifiers
FT   CDS             complement(join(260848..261147,261229..261452,
FT                   261583..261697,261785..262090,262289..262345))
FT                   /codon_start=1
FT                   /gene_synonym="F7A7.220"
FT                   /gene_synonym="F7A7_220"
FT                   /locus_tag="AT5G01700"
FT                   /product="Protein phosphatase 2C family protein"
FT                   /note="Protein phosphatase 2C family protein; FUNCTIONS IN:
FT                   protein serine/threonine phosphatase activity, catalytic
FT                   activity; INVOLVED IN: biological_process unknown; LOCATED
FT                   IN: cellular_component unknown; EXPRESSED IN: 9 plant
FT                   structures; EXPRESSED DURING: L mature pollen stage, M
FT                   germinated pollen stage, 4 anthesis, petal differentiation
FT                   and expansion stage; CONTAINS InterPro DOMAIN/s: Protein
FT                   phosphatase 2C-related (InterPro:IPR001932), Protein
FT                   phosphatase 2C (InterPro:IPR015655), Protein phosphatase
FT                   2C, N-terminal (InterPro:IPR014045); BEST Arabidopsis
FT                   thaliana protein match is: Protein phosphatase 2C family
FT                   protein (TAIR:AT3G02750.2); Has 5490 Blast hits to 5489
FT                   proteins in 289 species: Archae - 0; Bacteria - 8; Metazoa
FT                   - 1364; Fungi - 619; Plants - 2389; Viruses - 5; Other
FT                   Eukaryotes - 1105 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01700"
FT                   /db_xref="GOA:Q6NKS1"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6NKS1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:BX831823.1"
FT                   /protein_id="AED90378.1"
FT                   /translation="MSIKQGKKGINQDAMTVWENFGGEEDTIFCGVFDGHGPMGHKISR
FT                   HVCENLPSRVHSKIRSSKSAGDENIENNSSQSQEELFREFEDILVTFFKQIDSELGLDS
FT                   PYDSFCSGTTAVTVFKQADCLVIANLGHSRAVLGTRSKNSFKAVQLTVDLKPCVQREAE
FT                   RIVSCKGRVFAMEEEPDVYRVWMPDDDCPGLAMSRAFGDFCLKDYGLVCIPDVFCRKVS
FT                   REDEFVVLATDGIWDVLSNEEVVKVVGSCKDRSVAAEMLVQRAARTWRTKFPASKADDC
FT                   AVVVLYLNHRPYPREGNVSRAISTISWRSNKSNNECYGAAPLSPLGLSQRVS"
     MSIKQGKKGI NQDAMTVWEN FGGEEDTIFC GVFDGHGPMG HKISRHVCEN LPSRVHSKIR        60
     SSKSAGDENI ENNSSQSQEE LFREFEDILV TFFKQIDSEL GLDSPYDSFC SGTTAVTVFK       120
     QADCLVIANL GHSRAVLGTR SKNSFKAVQL TVDLKPCVQR EAERIVSCKG RVFAMEEEPD       180
     VYRVWMPDDD CPGLAMSRAF GDFCLKDYGL VCIPDVFCRK VSREDEFVVL ATDGIWDVLS       240
     NEEVVKVVGS CKDRSVAAEM LVQRAARTWR TKFPASKADD CAVVVLYLNH RPYPREGNVS       300
     RAISTISWRS NKSNNECYGA APLSPLGLSQ RVS                                    333
//

If you have problems or comments...

PBIL Back to PBIL home page