(data stored in ACNUC13479 zone)

EMBL: CP002688.PE131

CP002688.PE131       Location/Qualifiers
FT   CDS             complement(263709..265250)
FT                   /codon_start=1
FT                   /gene_synonym="F7A7.230"
FT                   /gene_synonym="F7A7_230"
FT                   /locus_tag="AT5G01710"
FT                   /product="methyltransferase"
FT                   /note="methyltransferases; FUNCTIONS IN: methyltransferase
FT                   activity; INVOLVED IN: metabolic process; LOCATED IN:
FT                   endomembrane system; EXPRESSED IN: sperm cell, male
FT                   gametophyte, pollen tube; EXPRESSED DURING: L mature pollen
FT                   stage, M germinated pollen stage; CONTAINS InterPro
FT                   DOMAIN/s: Methyltransferase FkbM (InterPro:IPR006342),
FT                   Methyltransferase type 11 (InterPro:IPR013216); BEST
FT                   Arabidopsis thaliana protein match is: unknown protein
FT                   (TAIR:AT3G53400.1); Has 1807 Blast hits to 1807 proteins in
FT                   277 species: Archae - 0; Bacteria - 0; Metazoa - 736; Fungi
FT                   - 347; Plants - 385; Viruses - 0; Other Eukaryotes - 339
FT                   (source: NCBI BLink)."
FT                   /db_xref="GOA:Q9M005"
FT                   /db_xref="InterPro:IPR006342"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q9M005"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:CF773980.1,INSD:EG443085.1,INSD:EH817539.1,
FT                   INSD:BP647620.1,INSD:EL289107.1,INSD:EL181351.1,
FT                   INSD:AV540969.1,INSD:BE522910.1,INSD:EL072035.1,
FT                   INSD:W43410.1,INSD:EH982582.1,INSD:BP599580.1,
FT                   INSD:AV566181.1,INSD:BP841876.1,INSD:DR380759.1,
FT                   INSD:EL313762.1,INSD:T76053.1,INSD:EH883977.1,
FT                   INSD:AV784527.1,INSD:BE521478.1,INSD:EH953050.1,
FT                   INSD:BP865296.1,INSD:EH907257.1,INSD:BP588897.1,
FT                   INSD:BP624674.1,INSD:EL223515.1,INSD:BP598554.1,
FT                   INSD:BP593845.1,INSD:AV551908.1,INSD:EL122522.1,
FT                   INSD:EH803671.1,INSD:Z34188.1,INSD:EL991498.1,
FT                   INSD:Z34608.1,INSD:BP795867.1,INSD:CD530100.1,
FT                   INSD:AV823538.1,INSD:AV541112.1,INSD:BP846823.1,
FT                   INSD:N96523.1,INSD:DR362437.1,INSD:CB262888.1,
FT                   INSD:ES138069.1,INSD:BE521154.1,INSD:EL302614.1,
FT                   INSD:BP631664.1,INSD:EH889277.1,INSD:BP659729.1,
FT                   INSD:BP620795.1,INSD:T76061.1,INSD:ES210573.1,
FT                   INSD:BE528634.1,INSD:AI993715.1,INSD:ES020781.1,
FT                   INSD:BP592681.1,INSD:BE526422.1,INSD:EL004399.1,
FT                   INSD:DR362436.1,INSD:BE529912.1,INSD:BE526246.1,
FT                   INSD:EG443086.1,INSD:BP590806.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY056223.1,INSD:BX831689.1,INSD:BX830348.1,
FT                   INSD:AF083794.1,INSD:AY142665.1"
FT                   /protein_id="AED90380.1"
FT                   /translation="METSMGKPSFLRNIMVRVLLFGVLIIVVRFAYVVTITGESCNRGD
FT                   FCFFSLPENLNFVISGAASGSSAIDAIRSTSPGDDLYTTRDWIKSVQFYSSIFQDLIAD
FT                   GYLSPESKTLCVETAIGQEVHSLREIGVKNSVGISKKASRPLVVRGEGHAIPFEDNAFD
FT                   FVFSGGDRLGKSLKQLEFADEITRTLKPEGFAVVHVGATDTYSFNSFLDLFNSCRLVKM
FT                   RDIDGFDPSMPHIREFVIQKYSEIDGGGHHHRGGGDSGGKCWIPGYKRDLIRDAEPLIQ
FT                   EEPLKPWITLKRNIKNIKYVPSMVDIRFKSRYVYVDVGARSYGSSIGSWFKKEYPKQNK
FT                   TFDVFAIEADKAFHEEYKIKKKVNLLPYAAWVRNETLSFEINHDPGKEVEAKAKGRGMG
FT                   RIQPVKKSDSSDLAGEVNLIQGFDFADWLKKSVRERDFVVMKMDVEGTEFDLIPRLIKT
FT                   GAICLIDELFLECHYNRWQRCCPGQRSQKYNKTYNQCLELFNSLRQRGVLVHQWW"
     METSMGKPSF LRNIMVRVLL FGVLIIVVRF AYVVTITGES CNRGDFCFFS LPENLNFVIS        60
     GAASGSSAID AIRSTSPGDD LYTTRDWIKS VQFYSSIFQD LIADGYLSPE SKTLCVETAI       120
     GQEVHSLREI GVKNSVGISK KASRPLVVRG EGHAIPFEDN AFDFVFSGGD RLGKSLKQLE       180
     FADEITRTLK PEGFAVVHVG ATDTYSFNSF LDLFNSCRLV KMRDIDGFDP SMPHIREFVI       240
     QKYSEIDGGG HHHRGGGDSG GKCWIPGYKR DLIRDAEPLI QEEPLKPWIT LKRNIKNIKY       300
     VPSMVDIRFK SRYVYVDVGA RSYGSSIGSW FKKEYPKQNK TFDVFAIEAD KAFHEEYKIK       360
     KKVNLLPYAA WVRNETLSFE INHDPGKEVE AKAKGRGMGR IQPVKKSDSS DLAGEVNLIQ       420
     GFDFADWLKK SVRERDFVVM KMDVEGTEFD LIPRLIKTGA ICLIDELFLE CHYNRWQRCC       480
     PGQRSQKYNK TYNQCLELFN SLRQRGVLVH QWW                                    513
//

If you have problems or comments...

PBIL Back to PBIL home page