(data stored in ACNUC13479 zone)

EMBL: CP002688.PE132

CP002688.PE132       Location/Qualifiers
FT   CDS             complement(join(267118..267171,267315..267566,
FT                   267657..267951,268032..268161,268247..268643,
FT                   268895..268999,269351..269476,269753..270391))
FT                   /codon_start=1
FT                   /gene_synonym="F7A7.240"
FT                   /gene_synonym="F7A7_240"
FT                   /locus_tag="AT5G01720"
FT                   /product="RNI-like superfamily protein"
FT                   /note="RNI-like superfamily protein; FUNCTIONS IN:
FT                   ubiquitin-protein ligase activity; INVOLVED IN:
FT                   ubiquitin-dependent protein catabolic process; LOCATED IN:
FT                   endomembrane system; EXPRESSED IN: 17 plant structures;
FT                   EXPRESSED DURING: 8 growth stages; CONTAINS InterPro
FT                   DOMAIN/s: Leucine-rich repeat, cysteine-containing subtype
FT                   (InterPro:IPR006553); BEST Arabidopsis thaliana protein
FT                   match is: F-box family protein (TAIR:AT5G27920.1); Has
FT                   15959 Blast hits to 6468 proteins in 357 species: Archae -
FT                   0; Bacteria - 920; Metazoa - 6194; Fungi - 1434; Plants -
FT                   4975; Viruses - 16; Other Eukaryotes - 2420 (source: NCBI
FT                   BLink)."
FT                   /db_xref="GOA:Q8RWU5"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR006553"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RWU5"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EH971110.1,INSD:BP838681.1,INSD:ES157889.1,
FT                   INSD:AV831599.1,INSD:AV530096.1,INSD:ES197841.1,
FT                   INSD:EH852755.1,INSD:AV524232.1,INSD:ES141206.1,
FT                   INSD:DR349128.1,INSD:BP816558.1,INSD:BE525539.1,
FT                   INSD:AA651109.1,INSD:BP828560.1,INSD:EH993152.1,
FT                   INSD:CB252999.1,INSD:EL004558.1,INSD:AV816937.1,
FT                   INSD:BP840029.1,INSD:BP819491.1,INSD:AU230138.1,
FT                   INSD:BP827837.1,INSD:BP840154.1,INSD:AV534404.1,
FT                   INSD:AU238890.1,INSD:DR288402.1,INSD:AV534461.1,
FT                   INSD:ES193526.1,INSD:EL156940.1,INSD:DR381930.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BX832007.1,INSD:AY086589.1,INSD:AY091103.1,
FT                   INSD:AK229588.1,INSD:AY122938.1"
FT                   /protein_id="AED90382.1"
FT                   /translation="MKKVKQIRVLKPFDLLSEELVFIILDLISPNPSDLKSFSLTCKSF
FT                   YQLESKHRGSLKPLRSDYLPRILTRYRNTTDLDLTFCPRVTDYALSVVGCLSGPTLRSL
FT                   DLSRSGSFSAAGLLRLALKCVNLVEIDLSNATEMRDADAAVVAEARSLERLKLGRCKML
FT                   TDMGIGCIAVGCKKLNTVSLKWCVGVGDLGVGLLAVKCKDIRTLDLSYLPITGKCLHDI
FT                   LKLQHLEELLLEGCFGVDDDSLKSLRHDCKSLKKLDASSCQNLTHRGLTSLLSGAGYLQ
FT                   RLDLSHCSSVISLDFASSLKKVSALQSIRLDGCSVTPDGLKAIGTLCNSLKEVSLSKCV
FT                   SVTDEGLSSLVMKLKDLRKLDITCCRKLSRVSITQIANSCPLLVSLKMESCSLVSREAF
FT                   WLIGQKCRLLEELDLTDNEIDDEGLKSISSCLSLSSLKLGICLNITDKGLSYIGMGCSN
FT                   LRELDLYRSVGITDVGISTIAQGCIHLETINISYCQDITDKSLVSLSKCSLLQTFESRG
FT                   CPNITSQGLAAIAVRCKRLAKVDLKKCPSINDAGLLALAHFSQNLKQINVSDTAVTEVG
FT                   LLSLANIGCLQNIAVVNSSGLRPSGVAAALLGCGGLRKAKLHASLRSLLPLSLIHHLEA
FT                   RGCAFLWKDNTLQAELDPKYWKQQLEEMAP"
     MKKVKQIRVL KPFDLLSEEL VFIILDLISP NPSDLKSFSL TCKSFYQLES KHRGSLKPLR        60
     SDYLPRILTR YRNTTDLDLT FCPRVTDYAL SVVGCLSGPT LRSLDLSRSG SFSAAGLLRL       120
     ALKCVNLVEI DLSNATEMRD ADAAVVAEAR SLERLKLGRC KMLTDMGIGC IAVGCKKLNT       180
     VSLKWCVGVG DLGVGLLAVK CKDIRTLDLS YLPITGKCLH DILKLQHLEE LLLEGCFGVD       240
     DDSLKSLRHD CKSLKKLDAS SCQNLTHRGL TSLLSGAGYL QRLDLSHCSS VISLDFASSL       300
     KKVSALQSIR LDGCSVTPDG LKAIGTLCNS LKEVSLSKCV SVTDEGLSSL VMKLKDLRKL       360
     DITCCRKLSR VSITQIANSC PLLVSLKMES CSLVSREAFW LIGQKCRLLE ELDLTDNEID       420
     DEGLKSISSC LSLSSLKLGI CLNITDKGLS YIGMGCSNLR ELDLYRSVGI TDVGISTIAQ       480
     GCIHLETINI SYCQDITDKS LVSLSKCSLL QTFESRGCPN ITSQGLAAIA VRCKRLAKVD       540
     LKKCPSINDA GLLALAHFSQ NLKQINVSDT AVTEVGLLSL ANIGCLQNIA VVNSSGLRPS       600
     GVAAALLGCG GLRKAKLHAS LRSLLPLSLI HHLEARGCAF LWKDNTLQAE LDPKYWKQQL       660
     EEMAP                                                                   665
//

If you have problems or comments...

PBIL Back to PBIL home page