(data stored in ACNUC13479 zone)

EMBL: CP002688.PE137

CP002688.PE137       Location/Qualifiers
FT   CDS             complement(join(273019..273069,273192..273305,
FT                   273389..273475,273554..276179,276292..276353,
FT                   276490..276619,276703..276755))
FT                   /codon_start=1
FT                   /gene="SCAR4"
FT                   /gene_synonym="ATSCAR4"
FT                   /gene_synonym="F7A7.250"
FT                   /gene_synonym="F7A7_250"
FT                   /gene_synonym="SCAR family protein 4"
FT                   /gene_synonym="WAVE3"
FT                   /locus_tag="AT5G01730"
FT                   /product="SCAR family protein 4"
FT                   /db_xref="GOA:A0A1P8BBH5"
FT                   /db_xref="InterPro:IPR028288"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1P8BBH5"
FT                   /protein_id="ANM68922.1"
FT                   /translation="MDSYEECHGPPQLFLLDKFDVAGSGSCLKRYSDPSLLKTHTTSAV
FT                   VATSKLGKDKRLRQSKKKGSHTTIKETPEDSRTSHAKLHQLFFLEHVENGHRNPEFHVK
FT                   LKRRQLNGPPINSSSGASYMEKFLKNSSPYCERVHGTMDQSSPAMETEVTVCSEQEDLP
FT                   IPSLVYSNSGGTRKYNEMEIESIAGHEILEIPFVPHEITVNEKSPVVCLESSSSVNLCC
FT                   KTNNDADSPASTESEVKEAGSDDKAGCDHGFPGFGQPQICTNAEVNQTEVLTQFSNVLR
FT                   HSPEEGESSLLCTDIQRASPESKPHKAEEAAVDLDESFSQMTPDIDSAGMGTLEILQTP
FT                   FSLSCYESPANLPEDSGSHLELQSNKANAEACEVFEVRRDPMLNISPETHLLKVTQVPQ
FT                   DAYEGGTNDVHSQHVFSVETASEISVSALVEDQFSSITNQEIEALESEDISSEAGHFIP
FT                   DTKKSLNETSVALESDFLLPNHYISTFDNFEDLSLSADAQDYAAPKEDETNSQDGSSMN
FT                   PAQSKHISTSEISSENGTLMSDTPRDLHTGYGSLSASSCLEDGLANPDLAEISSYSGQE
FT                   DPQTMSIVSDDSSDPEVPIPDGTCFAGDVDHDNQTGLNNKAIETVPQKELETISDPQES
FT                   LLGTEECLSSEYCLQIQNQRQESPSETGSANSRTSSDESPPTQNGSVGVQSSPLDVFPS
FT                   SITEIEALHAPYQEIFTSLNDHISESVLSKGLTDEEDFLNVSPESILPLSTSLHETPQA
FT                   NPEITPPLPPLPPTQWWMGKLVESTEMPSLAGSGNNSFNIQRDENTQNGSVQANEAQYP
FT                   SEVSVTDGENHNFHIYTEESKATEEQSPSGVNGTSDTYMESKHKCLNRTPEDSFSLAES
FT                   AQGLEADWRTEAMALEWFSQNLREHNNPHPAKLEEEEPQVDHPLEKPGQTKFRQTLRDN
FT                   NSYNQNQKAGKLKRDEDTLVIGIDRSMLRKVSEGNRTHVGARVDENDSLLEIIRSKSFN
FT                   LRPADASGRPNFQVAVPKTNLKVAAILEKANTLRQAMAGSDDEHDSDSWSE"
     MDSYEECHGP PQLFLLDKFD VAGSGSCLKR YSDPSLLKTH TTSAVVATSK LGKDKRLRQS        60
     KKKGSHTTIK ETPEDSRTSH AKLHQLFFLE HVENGHRNPE FHVKLKRRQL NGPPINSSSG       120
     ASYMEKFLKN SSPYCERVHG TMDQSSPAME TEVTVCSEQE DLPIPSLVYS NSGGTRKYNE       180
     MEIESIAGHE ILEIPFVPHE ITVNEKSPVV CLESSSSVNL CCKTNNDADS PASTESEVKE       240
     AGSDDKAGCD HGFPGFGQPQ ICTNAEVNQT EVLTQFSNVL RHSPEEGESS LLCTDIQRAS       300
     PESKPHKAEE AAVDLDESFS QMTPDIDSAG MGTLEILQTP FSLSCYESPA NLPEDSGSHL       360
     ELQSNKANAE ACEVFEVRRD PMLNISPETH LLKVTQVPQD AYEGGTNDVH SQHVFSVETA       420
     SEISVSALVE DQFSSITNQE IEALESEDIS SEAGHFIPDT KKSLNETSVA LESDFLLPNH       480
     YISTFDNFED LSLSADAQDY AAPKEDETNS QDGSSMNPAQ SKHISTSEIS SENGTLMSDT       540
     PRDLHTGYGS LSASSCLEDG LANPDLAEIS SYSGQEDPQT MSIVSDDSSD PEVPIPDGTC       600
     FAGDVDHDNQ TGLNNKAIET VPQKELETIS DPQESLLGTE ECLSSEYCLQ IQNQRQESPS       660
     ETGSANSRTS SDESPPTQNG SVGVQSSPLD VFPSSITEIE ALHAPYQEIF TSLNDHISES       720
     VLSKGLTDEE DFLNVSPESI LPLSTSLHET PQANPEITPP LPPLPPTQWW MGKLVESTEM       780
     PSLAGSGNNS FNIQRDENTQ NGSVQANEAQ YPSEVSVTDG ENHNFHIYTE ESKATEEQSP       840
     SGVNGTSDTY MESKHKCLNR TPEDSFSLAE SAQGLEADWR TEAMALEWFS QNLREHNNPH       900
     PAKLEEEEPQ VDHPLEKPGQ TKFRQTLRDN NSYNQNQKAG KLKRDEDTLV IGIDRSMLRK       960
     VSEGNRTHVG ARVDENDSLL EIIRSKSFNL RPADASGRPN FQVAVPKTNL KVAAILEKAN      1020
     TLRQAMAGSD DEHDSDSWSE                                                  1040
//

If you have problems or comments...

PBIL Back to PBIL home page