(data stored in ACNUC13479 zone)

EMBL: CP002688.PE138

CP002688.PE138       Location/Qualifiers
FT   CDS             complement(join(273019..273069,273192..273305,
FT                   273389..273475,273554..276055))
FT                   /codon_start=1
FT                   /gene="SCAR4"
FT                   /gene_synonym="ATSCAR4"
FT                   /gene_synonym="F7A7.250"
FT                   /gene_synonym="F7A7_250"
FT                   /gene_synonym="SCAR family protein 4"
FT                   /gene_synonym="WAVE3"
FT                   /locus_tag="AT5G01730"
FT                   /product="SCAR family protein 4"
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01730"
FT                   /db_xref="GOA:A0A1P8BBE5"
FT                   /db_xref="InterPro:IPR028288"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1P8BBE5"
FT                   /protein_id="ANM68920.1"
FT                   /translation="MEKFLKNSSPYCERVHGTMDQSSPAMETEVTVCSEQEDLPIPSLV
FT                   YSNSGGTRKYNEMEIESIAGHEILEIPFVPHEITVNEKSPVVCLESSSSVNLCCKTNND
FT                   ADSPASTESEVKEAGSDDKAGCDHGFPGFGQPQICTNAEVNQTEVLTQFSNVLRHSPEE
FT                   GESSLLCTDIQRASPESKPHKAEEAAVDLDESFSQMTPDIDSAGMGTLEILQTPFSLSC
FT                   YESPANLPEDSGSHLELQSNKANAEACEVFEVRRDPMLNISPETHLLKVTQVPQDAYEG
FT                   GTNDVHSQHVFSVETASEISVSALVEDQFSSITNQEIEALESEDISSEAGHFIPDTKKS
FT                   LNETSVALESDFLLPNHYISTFDNFEDLSLSADAQDYAAPKEDETNSQDGSSMNPAQSK
FT                   HISTSEISSENGTLMSDTPRDLHTGYGSLSASSCLEDGLANPDLAEISSYSGQEDPQTM
FT                   SIVSDDSSDPEVPIPDGTCFAGDVDHDNQTGLNNKAIETVPQKELETISDPQESLLGTE
FT                   ECLSSEYCLQIQNQRQESPSETGSANSRTSSDESPPTQNGSVGVQSSPLDVFPSSITEI
FT                   EALHAPYQEIFTSLNDHISESVLSKGLTDEEDFLNVSPESILPLSTSLHETPQANPEIT
FT                   PPLPPLPPTQWWMGKLVESTEMPSLAGSGNNSFNIQRDENTQNGSVQANEAQYPSEVSV
FT                   TDGENHNFHIYTEESKATEEQSPSGVNGTSDTYMESKHKCLNRTPEDSFSLAESAQGLE
FT                   ADWRTEAMALEWFSQNLREHNNPHPAKLEEEEPQVDHPLEKPGQTKFRQTLRDNNSYNQ
FT                   NQKAGKLKRDEDTLVIGIDRSMLRKVSEGNRTHVGARVDENDSLLEIIRSKSFNLRPAD
FT                   ASGRPNFQVAVPKTNLKVAAILEKANTLRQAMAGSDDEHDSDSWSE"
     MEKFLKNSSP YCERVHGTMD QSSPAMETEV TVCSEQEDLP IPSLVYSNSG GTRKYNEMEI        60
     ESIAGHEILE IPFVPHEITV NEKSPVVCLE SSSSVNLCCK TNNDADSPAS TESEVKEAGS       120
     DDKAGCDHGF PGFGQPQICT NAEVNQTEVL TQFSNVLRHS PEEGESSLLC TDIQRASPES       180
     KPHKAEEAAV DLDESFSQMT PDIDSAGMGT LEILQTPFSL SCYESPANLP EDSGSHLELQ       240
     SNKANAEACE VFEVRRDPML NISPETHLLK VTQVPQDAYE GGTNDVHSQH VFSVETASEI       300
     SVSALVEDQF SSITNQEIEA LESEDISSEA GHFIPDTKKS LNETSVALES DFLLPNHYIS       360
     TFDNFEDLSL SADAQDYAAP KEDETNSQDG SSMNPAQSKH ISTSEISSEN GTLMSDTPRD       420
     LHTGYGSLSA SSCLEDGLAN PDLAEISSYS GQEDPQTMSI VSDDSSDPEV PIPDGTCFAG       480
     DVDHDNQTGL NNKAIETVPQ KELETISDPQ ESLLGTEECL SSEYCLQIQN QRQESPSETG       540
     SANSRTSSDE SPPTQNGSVG VQSSPLDVFP SSITEIEALH APYQEIFTSL NDHISESVLS       600
     KGLTDEEDFL NVSPESILPL STSLHETPQA NPEITPPLPP LPPTQWWMGK LVESTEMPSL       660
     AGSGNNSFNI QRDENTQNGS VQANEAQYPS EVSVTDGENH NFHIYTEESK ATEEQSPSGV       720
     NGTSDTYMES KHKCLNRTPE DSFSLAESAQ GLEADWRTEA MALEWFSQNL REHNNPHPAK       780
     LEEEEPQVDH PLEKPGQTKF RQTLRDNNSY NQNQKAGKLK RDEDTLVIGI DRSMLRKVSE       840
     GNRTHVGARV DENDSLLEII RSKSFNLRPA DASGRPNFQV AVPKTNLKVA AILEKANTLR       900
     QAMAGSDDEH DSDSWSE                                                      917
//

If you have problems or comments...

PBIL Back to PBIL home page