(data stored in ACNUC13479 zone)

EMBL: CP002688.PE14

CP002688.PE14        Location/Qualifiers
FT   CDS             complement(join(18209..18393,18481..19449,19570..19680,
FT                   19970..20214,20358..20509,20714..20812))
FT                   /codon_start=1
FT                   /gene_synonym="F7J8.30"
FT                   /gene_synonym="F7J8_30"
FT                   /gene_synonym="LAC9"
FT                   /locus_tag="AT5G01050"
FT                   /product="Laccase/Diphenol oxidase family protein"
FT                   /note="Laccase/Diphenol oxidase family protein; FUNCTIONS
FT                   IN: laccase activity; INVOLVED IN: oxidation reduction,
FT                   lignin catabolic process; LOCATED IN: endomembrane system,
FT                   apoplast; EXPRESSED IN: root, flower; CONTAINS InterPro
FT                   DOMAIN/s: Multicopper oxidase, type 3 (InterPro:IPR011707),
FT                   Laccase (InterPro:IPR017761), Multicopper oxidase, type 2
FT                   (InterPro:IPR011706), Cupredoxin (InterPro:IPR008972),
FT                   Multicopper oxidase, type 1 (InterPro:IPR001117); BEST
FT                   Arabidopsis thaliana protein match is: laccase 8
FT                   (TAIR:AT5G01040.1); Has 1807 Blast hits to 1807 proteins in
FT                   277 species: Archae - 0; Bacteria - 0; Metazoa - 736; Fungi
FT                   - 347; Plants - 385; Viruses - 0; Other Eukaryotes - 339
FT                   (source: NCBI BLink)."
FT                   /db_xref="GOA:Q9LFD1"
FT                   /db_xref="InterPro:IPR001117"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011706"
FT                   /db_xref="InterPro:IPR011707"
FT                   /db_xref="InterPro:IPR017761"
FT                   /db_xref="InterPro:IPR034285"
FT                   /db_xref="InterPro:IPR034288"
FT                   /db_xref="InterPro:IPR034289"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9LFD1"
FT                   /inference="similar to RNA sequence, EST:INSD:AV548905.1"
FT                   /protein_id="AED90292.1"
FT                   /translation="MPRVHHSLSNQAFLVLLLFSSIASAAIVEHVLHVKDVVVTPLCKE
FT                   QMIPIVNGSLPGPTINVREGDTLVVHVINKSTYNVTIHWHGVFQLKSVWMDGANMITQC
FT                   PIQPSNNFTYQFDITGQEGTLLWHAHVVNLRATIHGALIIRPRSGRPYPFPKPYKEVPL
FT                   IFQQWWDTDVRLLELRPAPVSDAYLINGLAGDSYPCSKNRMFNLKVVQGKTYLLRIINA
FT                   ALNTHLFFKIANHNVTVVAVDAVYTTPYLTDVMILTPGQTIDAILTADQPIGTYYMAII
FT                   PYFSAIGVPASPDTKPTRGLIVYEGATSSSSPTKPWMPPANDIPTAHRFSSNITSLVGG
FT                   PHWTPVPRHVDEKMFITMGLGLDPCPSNAKCVGPLDQRLAGSLNNRTFMIPERISMQEA
FT                   YFYNITGVYTDDFPDQPPLKFDFTKFEQHPTNSDMEMMFPERKTSVKTIRFNSTVEIVL
FT                   QNTGILTPESHPMHLHGFNFYVLGYGFGNYDPIRDARKLNLFNPQMHNTVGVPPGGWVV
FT                   LRFIANNPGIWLFHCHMDAHLPLGIMMAFIVQNGPTRETSLPSPPSNLPQCTRDPTIYD
FT                   SRTTNVDMSY"
     MPRVHHSLSN QAFLVLLLFS SIASAAIVEH VLHVKDVVVT PLCKEQMIPI VNGSLPGPTI        60
     NVREGDTLVV HVINKSTYNV TIHWHGVFQL KSVWMDGANM ITQCPIQPSN NFTYQFDITG       120
     QEGTLLWHAH VVNLRATIHG ALIIRPRSGR PYPFPKPYKE VPLIFQQWWD TDVRLLELRP       180
     APVSDAYLIN GLAGDSYPCS KNRMFNLKVV QGKTYLLRII NAALNTHLFF KIANHNVTVV       240
     AVDAVYTTPY LTDVMILTPG QTIDAILTAD QPIGTYYMAI IPYFSAIGVP ASPDTKPTRG       300
     LIVYEGATSS SSPTKPWMPP ANDIPTAHRF SSNITSLVGG PHWTPVPRHV DEKMFITMGL       360
     GLDPCPSNAK CVGPLDQRLA GSLNNRTFMI PERISMQEAY FYNITGVYTD DFPDQPPLKF       420
     DFTKFEQHPT NSDMEMMFPE RKTSVKTIRF NSTVEIVLQN TGILTPESHP MHLHGFNFYV       480
     LGYGFGNYDP IRDARKLNLF NPQMHNTVGV PPGGWVVLRF IANNPGIWLF HCHMDAHLPL       540
     GIMMAFIVQN GPTRETSLPS PPSNLPQCTR DPTIYDSRTT NVDMSY                      586
//

If you have problems or comments...

PBIL Back to PBIL home page