(data stored in ACNUC13479 zone)

EMBL: CP002688.PE144

CP002688.PE144       Location/Qualifiers
FT   CDS             280793..281281
FT                   /codon_start=1
FT                   /gene_synonym="T20L15.10"
FT                   /gene_synonym="T20L15_10"
FT                   /locus_tag="AT5G01740"
FT                   /product="Nuclear transport factor 2 (NTF2) family protein"
FT                   /note="Nuclear transport factor 2 (NTF2) family protein;
FT                   CONTAINS InterPro DOMAIN/s: Wound-induced protein, Wun1
FT                   (InterPro:IPR009798); BEST Arabidopsis thaliana protein
FT                   match is: senescence associated gene 20 (TAIR:AT3G10985.1);
FT                   Has 1807 Blast hits to 1807 proteins in 277 species: Archae
FT                   - 0; Bacteria - 0; Metazoa - 736; Fungi - 347; Plants -
FT                   385; Viruses - 0; Other Eukaryotes - 339 (source: NCBI
FT                   BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01740"
FT                   /db_xref="GOA:Q9LZX2"
FT                   /db_xref="InterPro:IPR009798"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:Q9LZX2"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:BP561180.1,INSD:AV801748.1,INSD:EL061742.1,
FT                   INSD:EL253127.1,INSD:DR381603.1,INSD:EL044656.1,
FT                   INSD:BP843349.1,INSD:BP663016.1,INSD:EH919201.1,
FT                   INSD:EL125910.1,INSD:EL299142.1,INSD:AV785326.1,
FT                   INSD:EH806022.1,INSD:EL225895.1,INSD:EH796608.1,
FT                   INSD:EL115784.1,INSD:EH935016.1,INSD:BP846951.1,
FT                   INSD:EL044843.1,INSD:EL064426.1,INSD:EH917951.1,
FT                   INSD:EL096076.1,INSD:EL135985.1,INSD:EH968314.1,
FT                   INSD:EH856352.1,INSD:EH803158.1,INSD:EL050959.1,
FT                   INSD:BP662570.1,INSD:EH833407.1,INSD:BP861266.1,
FT                   INSD:EH978411.1,INSD:BP651008.1,INSD:EL216475.1,
FT                   INSD:EL079543.1,INSD:EL288553.1,INSD:EL027171.1,
FT                   INSD:DR350255.1,INSD:EH966641.1,INSD:EL230991.1,
FT                   INSD:EL231937.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY075604.1,INSD:BT014870.1,INSD:AY089058.1"
FT                   /protein_id="AED90385.1"
FT                   /translation="MEAHNVEISTRLTPEMKNQGTIELLYKALQQGDTSTVTKVVASDV
FT                   EWWFHGPHDCQHMMRLLTGEPPRQVSFRFEPSSVQVVVPGHDCVIAEGWEGSRVYWVHV
FT                   WKLKDGVVTELREYFNTWLTVTDYSLGAVGWDMGRCTVWESVPRDLARGSLPSLLLAI"
     MEAHNVEIST RLTPEMKNQG TIELLYKALQ QGDTSTVTKV VASDVEWWFH GPHDCQHMMR        60
     LLTGEPPRQV SFRFEPSSVQ VVVPGHDCVI AEGWEGSRVY WVHVWKLKDG VVTELREYFN       120
     TWLTVTDYSL GAVGWDMGRC TVWESVPRDL ARGSLPSLLL AI                          162
//

If you have problems or comments...

PBIL Back to PBIL home page