(data stored in ACNUC13479 zone)

EMBL: CP002688.PE145

CP002688.PE145       Location/Qualifiers
FT   CDS             join(290034..290315,290443..290670,290966..291109)
FT                   /codon_start=1
FT                   /gene_synonym="T20L15.20"
FT                   /gene_synonym="T20L15_20"
FT                   /locus_tag="AT5G01750"
FT                   /product="LURP-one-like protein (DUF567)"
FT                   /note="Protein of unknown function (DUF567); FUNCTIONS IN:
FT                   molecular_function unknown; INVOLVED IN: biological_process
FT                   unknown; LOCATED IN: chloroplast; EXPRESSED IN: 23 plant
FT                   structures; EXPRESSED DURING: 13 growth stages; CONTAINS
FT                   InterPro DOMAIN/s: Protein of unknown function DUF567
FT                   (InterPro:IPR007612); BEST Arabidopsis thaliana protein
FT                   match is: Protein of unknown function (DUF567)
FT                   (TAIR:AT3G11740.1); Has 468 Blast hits to 466 proteins in
FT                   44 species: Archae - 0; Bacteria - 29; Metazoa - 0; Fungi -
FT                   27; Plants - 412; Viruses - 0; Other Eukaryotes - 0
FT                   (source: NCBI BLink)."
FT                   /db_xref="GOA:Q9LZX1"
FT                   /db_xref="InterPro:IPR007612"
FT                   /db_xref="InterPro:IPR025659"
FT                   /db_xref="InterPro:IPR038595"
FT                   /db_xref="PDB:1ZXU"
FT                   /db_xref="PDB:2Q4M"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9LZX1"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EL980340.1,INSD:ES092266.1,INSD:DR316087.1,
FT                   INSD:DR358207.1,INSD:BP618413.1,INSD:EH980661.1,
FT                   INSD:EL215332.1,INSD:EH828907.1,INSD:BP836836.1,
FT                   INSD:DR358203.1,INSD:EL196476.1,INSD:BP652809.1,
FT                   INSD:EL160892.1,INSD:EL055921.1,INSD:EG446924.1,
FT                   INSD:EH913881.1,INSD:EL280873.1,INSD:ES142402.1,
FT                   INSD:EG481204.1,INSD:EL066272.1,INSD:EL993803.1,
FT                   INSD:ES023112.1,INSD:CB252414.1,INSD:EG447725.1,
FT                   INSD:EL316666.1,INSD:EG445940.1,INSD:EL228909.1,
FT                   INSD:EL129783.1,INSD:AV788635.1,INSD:CB259389.1,
FT                   INSD:BP855110.1,INSD:EL117135.1,INSD:T42596.1,
FT                   INSD:CB260128.1,INSD:EL262512.1,INSD:EL175224.1,
FT                   INSD:EL061321.1,INSD:ES028002.1,INSD:ES115316.1,
FT                   INSD:BP632794.1,INSD:DR358206.1,INSD:EL195477.1,
FT                   INSD:BP650532.1,INSD:EL078591.1,INSD:W43248.1,
FT                   INSD:ES017732.1,INSD:EL276194.1,INSD:EL983879.1,
FT                   INSD:EH836588.1,INSD:BE038953.1,INSD:EH804468.1,
FT                   INSD:EL300321.1,INSD:EH811841.1,INSD:EG512996.1,
FT                   INSD:AV545517.1,INSD:BP829010.1,INSD:EL080306.1,
FT                   INSD:EG421299.1,INSD:ES136720.1,INSD:BP853304.1,
FT                   INSD:BP629275.1,INSD:CB254109.1,INSD:ES007118.1,
FT                   INSD:EG421494.1,INSD:DR358205.1,INSD:BP617513.1,
FT                   INSD:EL312705.1,INSD:BP821217.1,INSD:AV821222.1,
FT                   INSD:EL163467.1,INSD:CD532427.1,INSD:EH805585.1,
FT                   INSD:DR316088.1,INSD:AV520101.1,INSD:EG445941.1,
FT                   INSD:EG419440.1,INSD:ES072927.1,INSD:DR259603.1,
FT                   INSD:EG419786.1,INSD:Z34868.1,INSD:R30135.1,
FT                   INSD:BP820367.1,INSD:BP828347.1,INSD:AV526198.1,
FT                   INSD:AV787457.1,INSD:AA721870.1,INSD:BP638621.1,
FT                   INSD:ES101816.1,INSD:AV553580.1,INSD:ES032319.1,
FT                   INSD:EG481205.1,INSD:DR358209.1,INSD:EL996642.1,
FT                   INSD:EH876830.1,INSD:EH960616.1,INSD:EL099481.1,
FT                   INSD:EG419470.1,INSD:AV532967.1,INSD:T42564.1,
FT                   INSD:EG445270.1,INSD:ES012956.1,INSD:N37667.1,
FT                   INSD:EL212695.1,INSD:EH894458.1,INSD:EL987615.1,
FT                   INSD:EH864532.1,INSD:EH867952.1,INSD:EL197381.1,
FT                   INSD:T46542.1,INSD:ES140458.1,INSD:EH810655.1,
FT                   INSD:EH911067.1,INSD:EL174033.1,INSD:EG444300.1,
FT                   INSD:T44947.1,INSD:BP657514.1,INSD:AV562636.1,
FT                   INSD:BP603769.1,INSD:AV553247.1,INSD:EL991652.1,
FT                   INSD:EL009979.1,INSD:BP654910.1,INSD:ES035271.1,
FT                   INSD:BP822864.1,INSD:DR259602.1,INSD:EL219317.1,
FT                   INSD:EG446093.1,INSD:EG512995.1,INSD:CB263328.1,
FT                   INSD:ES166032.1,INSD:EL155019.1,INSD:ES080621.1,
FT                   INSD:BP642313.1,INSD:EL285042.1,INSD:BP671586.1,
FT                   INSD:EG445518.1,INSD:DR350571.1,INSD:DR358202.1,
FT                   INSD:ES040879.1,INSD:DR383062.1,INSD:EG419595.1,
FT                   INSD:CB260088.1,INSD:EL104647.1,INSD:EL136622.1,
FT                   INSD:BP807051.1,INSD:EL275255.1,INSD:ES075885.1,
FT                   INSD:AV536277.1,INSD:EL200347.1,INSD:EH991836.1,
FT                   INSD:BP822838.1,INSD:EH882905.1,INSD:EH822048.1,
FT                   INSD:ES096397.1,INSD:AV560647.1,INSD:BP852115.1,
FT                   INSD:DR358204.1,INSD:BP667998.1,INSD:EG445691.1,
FT                   INSD:EL332416.1,INSD:CB252438.1,INSD:ES195211.1,
FT                   INSD:EL267514.1,INSD:DR358201.1,INSD:EH925056.1,
FT                   INSD:ES125222.1,INSD:EL029214.1,INSD:EL997083.1,
FT                   INSD:BP833555.1,INSD:AI997432.1,INSD:BP633883.1,
FT                   INSD:CB254258.1,INSD:ES123471.1,INSD:EL270096.1,
FT                   INSD:BP831152.1,INSD:ES157246.1,INSD:BP638443.1,
FT                   INSD:ES122880.1,INSD:AV786653.1,INSD:AV567679.1,
FT                   INSD:EL017720.1,INSD:EG444291.1,INSD:EL266955.1,
FT                   INSD:BP860061.1,INSD:EL030844.1,INSD:EG446194.1,
FT                   INSD:EG419797.1,INSD:AV544750.1,INSD:AV781556.1,
FT                   INSD:BP606647.1,INSD:AV554258.1,INSD:ES106379.1,
FT                   INSD:EG443729.1,INSD:DR358208.1,INSD:EL213022.1,
FT                   INSD:EG443730.1,INSD:CB254110.1,INSD:EL026235.1,
FT                   INSD:ES097621.1,INSD:BP662677.1,INSD:DR259604.1,
FT                   INSD:BE038615.1,INSD:EL254036.1,INSD:AV566328.1,
FT                   INSD:EL314953.1,INSD:EG425753.1,INSD:EL274893.1,
FT                   INSD:AV789130.1,INSD:CB262288.1,INSD:EH850293.1,
FT                   INSD:BP639034.1,INSD:EH839936.1,INSD:Z35003.1,
FT                   INSD:BP625934.1,INSD:EL260736.1,INSD:EH978623.1,
FT                   INSD:EH871421.1,INSD:AV536937.1,INSD:EH873326.1,
FT                   INSD:ES025939.1,INSD:BP831850.1,INSD:EL135524.1,
FT                   INSD:BP610156.1,INSD:EH992711.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BX831294.1,INSD:AF372877.1,INSD:AY142034.1,
FT                   INSD:BX841669.1"
FT                   /protein_id="AED90387.1"
FT                   /translation="MEQPYVYAYPQGSGPSGAPTPQAGGVVVDPKYCAPYPIDMAIVRK
FT                   MMSLTDGNFVITDVNGNLLFKVKEPVFGLHDKRVLLDGSGTPVVTLREKMVSMHDRWQV
FT                   FRGGSTDQRDLLYTVKRSSMLQLKTKLDVFLGHNKDEKRCDFRVKGSWLERSCVVYAGE
FT                   SDAIVAQMHRKHTVQSVFLGKDNFSVTVYPNVDYAFIASLVVILDDVNREDRAA"
     MEQPYVYAYP QGSGPSGAPT PQAGGVVVDP KYCAPYPIDM AIVRKMMSLT DGNFVITDVN        60
     GNLLFKVKEP VFGLHDKRVL LDGSGTPVVT LREKMVSMHD RWQVFRGGST DQRDLLYTVK       120
     RSSMLQLKTK LDVFLGHNKD EKRCDFRVKG SWLERSCVVY AGESDAIVAQ MHRKHTVQSV       180
     FLGKDNFSVT VYPNVDYAFI ASLVVILDDV NREDRAA                                217
//

If you have problems or comments...

PBIL Back to PBIL home page