(data stored in ACNUC13479 zone)

EMBL: CP002688.PE146

CP002688.PE146       Location/Qualifiers
FT   CDS             join(290034..290315,290443..290685)
FT                   /codon_start=1
FT                   /gene_synonym="T20L15.20"
FT                   /gene_synonym="T20L15_20"
FT                   /locus_tag="AT5G01750"
FT                   /product="LURP-one-like protein (DUF567)"
FT                   /note="Protein of unknown function (DUF567); FUNCTIONS IN:
FT                   molecular_function unknown; INVOLVED IN: biological_process
FT                   unknown; LOCATED IN: chloroplast; EXPRESSED IN: 23 plant
FT                   structures; EXPRESSED DURING: 13 growth stages; CONTAINS
FT                   InterPro DOMAIN/s: Protein of unknown function DUF567
FT                   (InterPro:IPR007612); BEST Arabidopsis thaliana protein
FT                   match is: Protein of unknown function (DUF567)
FT                   (TAIR:AT1G33840.1); Has 30201 Blast hits to 17322 proteins
FT                   in 780 species: Archae - 12; Bacteria - 1396; Metazoa -
FT                   17338; Fungi - 3422; Plants - 5037; Viruses - 0; Other
FT                   Eukaryotes - 2996 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01750"
FT                   /db_xref="GOA:Q9LZX1"
FT                   /db_xref="InterPro:IPR007612"
FT                   /db_xref="InterPro:IPR025659"
FT                   /db_xref="InterPro:IPR038595"
FT                   /db_xref="PDB:1ZXU"
FT                   /db_xref="PDB:2Q4M"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9LZX1"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:ES140458.1,INSD:ES092266.1,INSD:DR316087.1,
FT                   INSD:EH810655.1,INSD:DR358207.1,INSD:EH911067.1,
FT                   INSD:EH980661.1,INSD:EL174033.1,INSD:T44947.1,
FT                   INSD:EL215332.1,INSD:EH828907.1,INSD:DR358203.1,
FT                   INSD:EL196476.1,INSD:EL160892.1,INSD:EH913881.1,
FT                   INSD:ES142402.1,INSD:AV553247.1,INSD:EL991652.1,
FT                   INSD:EL066272.1,INSD:EL993803.1,INSD:BP822864.1,
FT                   INSD:DR259602.1,INSD:EL316666.1,INSD:CB263328.1,
FT                   INSD:EL228909.1,INSD:ES166032.1,INSD:EL155019.1,
FT                   INSD:EL285042.1,INSD:DR350571.1,INSD:EL117135.1,
FT                   INSD:BP855110.1,INSD:T42596.1,INSD:CB260128.1,
FT                   INSD:EL262512.1,INSD:EL175224.1,INSD:ES115316.1,
FT                   INSD:DR358206.1,INSD:EL104647.1,INSD:EL136622.1,
FT                   INSD:BP807051.1,INSD:EL164658.1,INSD:W43248.1,
FT                   INSD:ES075885.1,INSD:EH991836.1,INSD:BP822838.1,
FT                   INSD:ES017732.1,INSD:EH882905.1,INSD:EH822048.1,
FT                   INSD:ES096397.1,INSD:EL276194.1,INSD:EL983879.1,
FT                   INSD:EH836588.1,INSD:BE038953.1,INSD:BP852115.1,
FT                   INSD:DR358204.1,INSD:EH811841.1,INSD:EL332416.1,
FT                   INSD:ES195211.1,INSD:BP829010.1,INSD:EH925056.1,
FT                   INSD:EL080306.1,INSD:ES125222.1,INSD:BP833555.1,
FT                   INSD:BP853304.1,INSD:CB254258.1,INSD:ES123471.1,
FT                   INSD:EL270096.1,INSD:BP831152.1,INSD:ES157246.1,
FT                   INSD:ES122880.1,INSD:EL254238.1,INSD:EL312705.1,
FT                   INSD:BP821217.1,INSD:EL017720.1,INSD:EL163467.1,
FT                   INSD:EL266955.1,INSD:BP860061.1,INSD:DR316088.1,
FT                   INSD:EG419797.1,INSD:ES072927.1,INSD:DR259603.1,
FT                   INSD:EG419786.1,INSD:Z34868.1,INSD:R30135.1,
FT                   INSD:BP820367.1,INSD:BP828347.1,INSD:AV526198.1,
FT                   INSD:AV554258.1,INSD:AA721870.1,INSD:ES101816.1,
FT                   INSD:AV553580.1,INSD:EL213022.1,INSD:DR372338.1,
FT                   INSD:ES097621.1,INSD:DR358209.1,INSD:DR259604.1,
FT                   INSD:EL254036.1,INSD:EL314953.1,INSD:EL274893.1,
FT                   INSD:EL099481.1,INSD:CB262288.1,INSD:T42564.1,
FT                   INSD:EH850293.1,INSD:N37667.1,INSD:EL212695.1,
FT                   INSD:EH839936.1,INSD:EL260736.1,INSD:EH978623.1,
FT                   INSD:EH871421.1,INSD:AV536937.1,INSD:EH873326.1,
FT                   INSD:ES025939.1,INSD:BP831850.1,INSD:EL197381.1,
FT                   INSD:T46542.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:AY085369.1"
FT                   /protein_id="AED90386.1"
FT                   /translation="MEQPYVYAYPQGSGPSGAPTPQAGGVVVDPKYCAPYPIDMAIVRK
FT                   MMSLTDGNFVITDVNGNLLFKVKEPVFGLHDKRVLLDGSGTPVVTLREKMVSMHDRWQV
FT                   FRGGSTDQRDLLYTVKRSSMLQLKTKLDVFLGHNKDEKRCDFRVKGSWLERSCVVYAGE
FT                   SDAIVAQVYYL"
     MEQPYVYAYP QGSGPSGAPT PQAGGVVVDP KYCAPYPIDM AIVRKMMSLT DGNFVITDVN        60
     GNLLFKVKEP VFGLHDKRVL LDGSGTPVVT LREKMVSMHD RWQVFRGGST DQRDLLYTVK       120
     RSSMLQLKTK LDVFLGHNKD EKRCDFRVKG SWLERSCVVY AGESDAIVAQ VYYL             174
//

If you have problems or comments...

PBIL Back to PBIL home page