(data stored in ACNUC13479 zone)

EMBL: CP002688.PE147

CP002688.PE147       Location/Qualifiers
FT   CDS             join(291753..291913,292000..292078,292175..292273,
FT                   292393..292506,292582..292745,292838..292919,
FT                   293013..293098,293200..293466,293551..294127)
FT                   /codon_start=1
FT                   /gene_synonym="T20L15.30"
FT                   /gene_synonym="T20L15_30"
FT                   /locus_tag="AT5G01760"
FT                   /product="ENTH/VHS/GAT family protein"
FT                   /note="ENTH/VHS/GAT family protein; FUNCTIONS IN: protein
FT                   transporter activity; INVOLVED IN: intracellular protein
FT                   transport, intra-Golgi vesicle-mediated transport; LOCATED
FT                   IN: Golgi stack, intracellular; CONTAINS InterPro DOMAIN/s:
FT                   VHS (InterPro:IPR002014), GAT (InterPro:IPR004152), VHS
FT                   subgroup (InterPro:IPR018205), ENTH/VHS
FT                   (InterPro:IPR008942); BEST Arabidopsis thaliana protein
FT                   match is: ENTH/VHS/GAT family protein (TAIR:AT2G38410.1);
FT                   Has 1737 Blast hits to 1724 proteins in 203 species: Archae
FT                   - 0; Bacteria - 8; Metazoa - 865; Fungi - 471; Plants -
FT                   276; Viruses - 2; Other Eukaryotes - 115 (source: NCBI
FT                   BLink)."
FT                   /db_xref="GOA:F4KAU9"
FT                   /db_xref="InterPro:IPR002014"
FT                   /db_xref="InterPro:IPR004152"
FT                   /db_xref="InterPro:IPR008942"
FT                   /db_xref="InterPro:IPR038425"
FT                   /db_xref="UniProtKB/Swiss-Prot:F4KAU9"
FT                   /inference="similar to RNA sequence, EST:INSD:AU230780.1"
FT                   /protein_id="AED90388.1"
FT                   /translation="MRPSCASSSSSSASPSLRLSSVTVAVDKATSELLRTPDWTIIIAI
FT                   CDSLNSNRWQCKDAIKAVKRRLQHKSSRVQLLTLTLLEAMLKNCGDFVHSHIAEKHLLE
FT                   DMVKLVRKKGDFEVRNKLLILLDTWNEAFSGVACKHPHYNWAYQELKRCGVKFPQRSKE
FT                   APLMLEPPPPVTQSSSSSSMNLMSIGSFRRLDETMATEIESLSLSSLESMRNVMDLVND
FT                   MVQAVNPSDKSALKDELIVDLVEQCRSNQKKLIQMLTTTADEDVLARGLELNDSLQVVL
FT                   ARHDAIASGVSLPLLLQAPEPRETSSSLKTCGAAALESADSESSSSSSSSESETDEVED
FT                   VKDDFIQLAKRHALLNALHSDEEEETLLLGNDNEKTAEAEAKTQCKDLALFDTTTTTTT
FT                   KSEQDIIELLSLTLSTTALPSPQTQPQTQHPSFFADDNILMNSYVVPWAQSQEEPQVPK
FT                   MTQFAPSGPQFQPWPLQQQQPYSYGYPQPQWSGGQVNSNDTTFWSQGGNENMVFERNLQ
FT                   VSNSFPARATGTSGAATAATVDRQP"
     MRPSCASSSS SSASPSLRLS SVTVAVDKAT SELLRTPDWT IIIAICDSLN SNRWQCKDAI        60
     KAVKRRLQHK SSRVQLLTLT LLEAMLKNCG DFVHSHIAEK HLLEDMVKLV RKKGDFEVRN       120
     KLLILLDTWN EAFSGVACKH PHYNWAYQEL KRCGVKFPQR SKEAPLMLEP PPPVTQSSSS       180
     SSMNLMSIGS FRRLDETMAT EIESLSLSSL ESMRNVMDLV NDMVQAVNPS DKSALKDELI       240
     VDLVEQCRSN QKKLIQMLTT TADEDVLARG LELNDSLQVV LARHDAIASG VSLPLLLQAP       300
     EPRETSSSLK TCGAAALESA DSESSSSSSS SESETDEVED VKDDFIQLAK RHALLNALHS       360
     DEEEETLLLG NDNEKTAEAE AKTQCKDLAL FDTTTTTTTK SEQDIIELLS LTLSTTALPS       420
     PQTQPQTQHP SFFADDNILM NSYVVPWAQS QEEPQVPKMT QFAPSGPQFQ PWPLQQQQPY       480
     SYGYPQPQWS GGQVNSNDTT FWSQGGNENM VFERNLQVSN SFPARATGTS GAATAATVDR       540
     QP                                                                      542
//

If you have problems or comments...

PBIL Back to PBIL home page