(data stored in ACNUC13479 zone)

EMBL: CP002688.PE149

CP002688.PE149       Location/Qualifiers
FT   CDS             complement(join(294539..294880,294961..295042,
FT                   295152..295237,295386..295487,295583..295728,
FT                   295828..295952,296266..296392,296485..296802,
FT                   296909..297475,297716..297896,297996..298349,
FT                   298667..298777,298881..298964,299183..299284,
FT                   299378..299456,299537..299681,299813..299967,
FT                   300464..300603,300703..300819,300902..301060,
FT                   301140..301225,301317..301419,301495..301773))
FT                   /codon_start=1
FT                   /gene="RAPTOR2"
FT                   /gene_synonym="ATRAPTOR1A"
FT                   /gene_synonym="RAPTOR1A"
FT                   /gene_synonym="T20L15.40"
FT                   /gene_synonym="T20L15_40"
FT                   /locus_tag="AT5G01770"
FT                   /product="regulatory-associated protein of TOR 2 (RAPTOR2)"
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01770"
FT                   /db_xref="GOA:A0A1P8BAR8"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR004083"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR029347"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1P8BAR8"
FT                   /protein_id="ANM68698.1"
FT                   /translation="MALGDLMVSRLSQSSVTVVTNHLYDDDDNCASSAHDDSRVSIIAS
FT                   PRVASSSYENLSAATSMAYLPQTLVLCDLRHDDASDIVQPPRWRLKERMKTGCVALVMC
FT                   LHITVDPPDVIKISPCARLECWIDPFSMFPPRRALEAIGQNLSIQYERWLARARYKVEL
FT                   DPTKDDVRKLCLSCRKYAKTERVLFHYNGHGVPKPTPNGEIWVYNKNFTQYIPLPVSEL
FT                   DSWLKTPTIYVFDCSAARVILNAFAEGESSGPPKDCILLAACDVHETLPQSVEFPADVF
FT                   TSCLTTPINIALKWFCRRSLLKEFIDESLIDRIPGRQNDRKTLLGELNWIFTAVTDTIA
FT                   WNVLPRELFQRLFRQDLLVASLFRNFLLAERIMRSGNCTPISHPMLPPTHQHHMWDAWD
FT                   MAAEICLSQLPQFFLDPNTEFQPSSFFTEQLTAFEVWLDHGSEHKKPPEQLPIVLQVLL
FT                   SQCHRYRALVLLGRFLDMGPWAVDLALSVGIYPCVVKLLQTTTIELRQILVFIWTKILA
FT                   LDKSCQVDLVKDRGHIYFIRFLDSSDAFPEQRAMAAFILAVIVDGYKRGQESCLEANLI
FT                   AVCLGHLEATQLCDPPPEPLFLQWLCLCLGKLWEDYLEAQIMGREANASEKLIPLLSEA
FT                   QPEVRAAAVFALGTLLDVGFDSGKGVCDEEFDDDENIVEDIIIKSLLDVVSDGSPLVRT
FT                   EVAVALARFAFGHKQHLKSVADSYWKPQNSLRTSLPSMAKFHDSGTSIVASSDMGSLTR
FT                   ASPDSQPVAREGRISSSLQEPFSGLMQGSPLADDSSLHSDVGIIHDGVSNGVVHQPRPL
FT                   DNAIYSQSVLAMFTLAKDPSPRIASLGRRVLSVIGIEQIVAKPSKSNGRPGEAASASHT
FT                   PLAGLVRSSSWFDMHTGHLPLTFRTPPVSPPQTSYLTGLRRVCSLELRPHLLGSPDSGL
FT                   ADPILGVSGSERSLLPQSTIYNWSCGHFSKPLLGGADANEEIAAQREEKKKFSLEHIAK
FT                   CQHSSISGLSNIPIANWDTKFETGTKTALLHPFSPIVVAADENERIRVWNYEEATLLNG
FT                   FDNNDFPDKGISNLCLVNELDDSLLLVASCDGSVRIWKDYATKGRQKLVTGFSSIQGQK
FT                   PGASGLNAVVDWQQQSGYLYVSGESLSIMVWDLDKEQLVKSMPFESGCSVTALSASQVH
FT                   GSQLAAGFADGSVRLYDVRTPDFLVCATRPHQRVEKVVGLSFQPGLDPAKIVSASQAGD
FT                   IQFLDLRRPKETYLTIDAHRGSLTALGVHRHAPIIASGSAKQLIKVFSLKGEQLGIIKY
FT                   HTSFMGQQIGPVSCLAFHPYQMLLAAGAAGSFVSLYTHHNTQLPR"
     MALGDLMVSR LSQSSVTVVT NHLYDDDDNC ASSAHDDSRV SIIASPRVAS SSYENLSAAT        60
     SMAYLPQTLV LCDLRHDDAS DIVQPPRWRL KERMKTGCVA LVMCLHITVD PPDVIKISPC       120
     ARLECWIDPF SMFPPRRALE AIGQNLSIQY ERWLARARYK VELDPTKDDV RKLCLSCRKY       180
     AKTERVLFHY NGHGVPKPTP NGEIWVYNKN FTQYIPLPVS ELDSWLKTPT IYVFDCSAAR       240
     VILNAFAEGE SSGPPKDCIL LAACDVHETL PQSVEFPADV FTSCLTTPIN IALKWFCRRS       300
     LLKEFIDESL IDRIPGRQND RKTLLGELNW IFTAVTDTIA WNVLPRELFQ RLFRQDLLVA       360
     SLFRNFLLAE RIMRSGNCTP ISHPMLPPTH QHHMWDAWDM AAEICLSQLP QFFLDPNTEF       420
     QPSSFFTEQL TAFEVWLDHG SEHKKPPEQL PIVLQVLLSQ CHRYRALVLL GRFLDMGPWA       480
     VDLALSVGIY PCVVKLLQTT TIELRQILVF IWTKILALDK SCQVDLVKDR GHIYFIRFLD       540
     SSDAFPEQRA MAAFILAVIV DGYKRGQESC LEANLIAVCL GHLEATQLCD PPPEPLFLQW       600
     LCLCLGKLWE DYLEAQIMGR EANASEKLIP LLSEAQPEVR AAAVFALGTL LDVGFDSGKG       660
     VCDEEFDDDE NIVEDIIIKS LLDVVSDGSP LVRTEVAVAL ARFAFGHKQH LKSVADSYWK       720
     PQNSLRTSLP SMAKFHDSGT SIVASSDMGS LTRASPDSQP VAREGRISSS LQEPFSGLMQ       780
     GSPLADDSSL HSDVGIIHDG VSNGVVHQPR PLDNAIYSQS VLAMFTLAKD PSPRIASLGR       840
     RVLSVIGIEQ IVAKPSKSNG RPGEAASASH TPLAGLVRSS SWFDMHTGHL PLTFRTPPVS       900
     PPQTSYLTGL RRVCSLELRP HLLGSPDSGL ADPILGVSGS ERSLLPQSTI YNWSCGHFSK       960
     PLLGGADANE EIAAQREEKK KFSLEHIAKC QHSSISGLSN IPIANWDTKF ETGTKTALLH      1020
     PFSPIVVAAD ENERIRVWNY EEATLLNGFD NNDFPDKGIS NLCLVNELDD SLLLVASCDG      1080
     SVRIWKDYAT KGRQKLVTGF SSIQGQKPGA SGLNAVVDWQ QQSGYLYVSG ESLSIMVWDL      1140
     DKEQLVKSMP FESGCSVTAL SASQVHGSQL AAGFADGSVR LYDVRTPDFL VCATRPHQRV      1200
     EKVVGLSFQP GLDPAKIVSA SQAGDIQFLD LRRPKETYLT IDAHRGSLTA LGVHRHAPII      1260
     ASGSAKQLIK VFSLKGEQLG IIKYHTSFMG QQIGPVSCLA FHPYQMLLAA GAAGSFVSLY      1320
     THHNTQLPR                                                              1329
//

If you have problems or comments...

PBIL Back to PBIL home page