(data stored in ACNUC13479 zone)

EMBL: CP002688.PE150

CP002688.PE150       Location/Qualifiers
FT   CDS             complement(join(294539..294880,294961..295042,
FT                   295152..295237,295386..295487,295583..295728,
FT                   295828..295952,296266..296392,296485..296802,
FT                   296909..297475,297716..297927,298030..298349,
FT                   298667..298777,298881..298964,299183..299284,
FT                   299378..299456,299537..299681,299813..299967,
FT                   300464..300612,300703..300819,300902..301060,
FT                   301140..301225,301317..301419,301495..301773))
FT                   /codon_start=1
FT                   /gene="RAPTOR2"
FT                   /gene_synonym="ATRAPTOR1A"
FT                   /gene_synonym="RAPTOR1A"
FT                   /gene_synonym="T20L15.40"
FT                   /gene_synonym="T20L15_40"
FT                   /locus_tag="AT5G01770"
FT                   /product="regulatory-associated protein of TOR 2 (RAPTOR2)"
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01770"
FT                   /db_xref="GOA:A0A1P8BAS5"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR004083"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR029347"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1P8BAS5"
FT                   /protein_id="ANM68699.1"
FT                   /translation="MALGDLMVSRLSQSSVTVVTNHLYDDDDNCASSAHDDSRVSIIAS
FT                   PRVASSSYENLSAATSMAYLPQTLVLCDLRHDDASDIVQPPRWRLKERMKTGCVALVMC
FT                   LHITVDPPDVIKISPCARLECWIDPFSMFPPRRALEAIGQNLSIQYERWLARARYKVEL
FT                   DPTKDDVRKLCLSCRKYAKTERVLFHYNGHGVPKPTPNGEIWVYNKNFTQYIPLPVSEL
FT                   DSWLKTPTIYVFDCSAARVILNAFAELHEGESSGPPKDCILLAACDVHETLPQSVEFPA
FT                   DVFTSCLTTPINIALKWFCRRSLLKEFIDESLIDRIPGRQNDRKTLLGELNWIFTAVTD
FT                   TIAWNVLPRELFQRLFRQDLLVASLFRNFLLAERIMRSGNCTPISHPMLPPTHQHHMWD
FT                   AWDMAAEICLSQLPQFFLDPNTEFQPSSFFTEQLTAFEVWLDHGSEHKKPPEQLPIVLQ
FT                   VLLSQCHRYRALVLLGRFLDMGPWAVDLALSVGIYPCVVKLLQTTTIELRQILVFIWTK
FT                   ILALDKSCQVDLVKDRGHIYFIRFLDSSDAFPEQRAMAAFILAVIVDGYKRGQESCLEA
FT                   NLIAVCLGHLEATQLCDPPPEPLFLQWLCLCLGKLWEDYLEAQIMGREANASENLIAGH
FT                   TNLLQVRAAAVFALGTLLDVGFDSGKGVCDEEFDDDENIVEDIIIKSLLDVVSDGSPLV
FT                   RTEVAVALARFAFGHKQHLKSVADSYWKPQNSLRTSLPSMAKFHDSGTSIVASSDMGSL
FT                   TRASPDSQPVAREGRISSSLQEPFSGLMQGSPLADDSSLHSDVGIIHDGVSNGVVHQPR
FT                   PLDNAIYSQSVLAMFTLAKDPSPRIASLGRRVLSVIGIEQIVAKPSKSNGRPGEAASAS
FT                   HTPLAGLVRSSSWFDMHTGHLPLTFRTPPVSPPQTSYLTGLRRVCSLELRPHLLGSPDS
FT                   GLADPILGVSGSERSLLPQSTIYNWSCGHFSKPLLGGADANEEIAAQREEKKKFSLEHI
FT                   AKCQHSSISGLSNIPIANWDTKFETGTKTALLHPFSPIVVAADENERIRVWNYEEATLL
FT                   NGFDNNDFPDKGISNLCLVNELDDSLLLVASCDGSVRIWKDYATKGRQKLVTGFSSIQG
FT                   QKPGASGLNAVVDWQQQSGYLYVSGESLSIMVWDLDKEQLVKSMPFESGCSVTALSASQ
FT                   VHGSQLAAGFADGSVRLYDVRTPDFLVCATRPHQRVEKVVGLSFQPGLDPAKIVSASQA
FT                   GDIQFLDLRRPKETYLTIDAHRGSLTALGVHRHAPIIASGSAKQLIKVFSLKGEQLGII
FT                   KYHTSFMGQQIGPVSCLAFHPYQMLLAAGAAGSFVSLYTHHNTQLPR"
     MALGDLMVSR LSQSSVTVVT NHLYDDDDNC ASSAHDDSRV SIIASPRVAS SSYENLSAAT        60
     SMAYLPQTLV LCDLRHDDAS DIVQPPRWRL KERMKTGCVA LVMCLHITVD PPDVIKISPC       120
     ARLECWIDPF SMFPPRRALE AIGQNLSIQY ERWLARARYK VELDPTKDDV RKLCLSCRKY       180
     AKTERVLFHY NGHGVPKPTP NGEIWVYNKN FTQYIPLPVS ELDSWLKTPT IYVFDCSAAR       240
     VILNAFAELH EGESSGPPKD CILLAACDVH ETLPQSVEFP ADVFTSCLTT PINIALKWFC       300
     RRSLLKEFID ESLIDRIPGR QNDRKTLLGE LNWIFTAVTD TIAWNVLPRE LFQRLFRQDL       360
     LVASLFRNFL LAERIMRSGN CTPISHPMLP PTHQHHMWDA WDMAAEICLS QLPQFFLDPN       420
     TEFQPSSFFT EQLTAFEVWL DHGSEHKKPP EQLPIVLQVL LSQCHRYRAL VLLGRFLDMG       480
     PWAVDLALSV GIYPCVVKLL QTTTIELRQI LVFIWTKILA LDKSCQVDLV KDRGHIYFIR       540
     FLDSSDAFPE QRAMAAFILA VIVDGYKRGQ ESCLEANLIA VCLGHLEATQ LCDPPPEPLF       600
     LQWLCLCLGK LWEDYLEAQI MGREANASEN LIAGHTNLLQ VRAAAVFALG TLLDVGFDSG       660
     KGVCDEEFDD DENIVEDIII KSLLDVVSDG SPLVRTEVAV ALARFAFGHK QHLKSVADSY       720
     WKPQNSLRTS LPSMAKFHDS GTSIVASSDM GSLTRASPDS QPVAREGRIS SSLQEPFSGL       780
     MQGSPLADDS SLHSDVGIIH DGVSNGVVHQ PRPLDNAIYS QSVLAMFTLA KDPSPRIASL       840
     GRRVLSVIGI EQIVAKPSKS NGRPGEAASA SHTPLAGLVR SSSWFDMHTG HLPLTFRTPP       900
     VSPPQTSYLT GLRRVCSLEL RPHLLGSPDS GLADPILGVS GSERSLLPQS TIYNWSCGHF       960
     SKPLLGGADA NEEIAAQREE KKKFSLEHIA KCQHSSISGL SNIPIANWDT KFETGTKTAL      1020
     LHPFSPIVVA ADENERIRVW NYEEATLLNG FDNNDFPDKG ISNLCLVNEL DDSLLLVASC      1080
     DGSVRIWKDY ATKGRQKLVT GFSSIQGQKP GASGLNAVVD WQQQSGYLYV SGESLSIMVW      1140
     DLDKEQLVKS MPFESGCSVT ALSASQVHGS QLAAGFADGS VRLYDVRTPD FLVCATRPHQ      1200
     RVEKVVGLSF QPGLDPAKIV SASQAGDIQF LDLRRPKETY LTIDAHRGSL TALGVHRHAP      1260
     IIASGSAKQL IKVFSLKGEQ LGIIKYHTSF MGQQIGPVSC LAFHPYQMLL AAGAAGSFVS      1320
     LYTHHNTQLP R                                                           1331
//

If you have problems or comments...

PBIL Back to PBIL home page