(data stored in ACNUC13479 zone)

EMBL: CP002688.PE151

CP002688.PE151       Location/Qualifiers
FT   CDS             complement(join(294539..294880,294961..295042,
FT                   295152..295237,295386..295487,295583..295728,
FT                   295828..295952,296266..296392,296485..296802,
FT                   296909..297475,297716..297896,297996..298349,
FT                   298667..298777,298881..298964,299183..299284,
FT                   299378..299456,299537..299681,299813..299967,
FT                   300464..300612,300703..300819,300902..301060,
FT                   301140..301225,301317..301419,301495..301773))
FT                   /codon_start=1
FT                   /gene="RAPTOR2"
FT                   /gene_synonym="ATRAPTOR1A"
FT                   /gene_synonym="RAPTOR1A"
FT                   /gene_synonym="T20L15.40"
FT                   /gene_synonym="T20L15_40"
FT                   /locus_tag="AT5G01770"
FT                   /product="regulatory-associated protein of TOR 2 (RAPTOR2)"
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01770"
FT                   /db_xref="GOA:A0A1P8BAT3"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR004083"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR029347"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1P8BAT3"
FT                   /protein_id="ANM68696.1"
FT                   /translation="MALGDLMVSRLSQSSVTVVTNHLYDDDDNCASSAHDDSRVSIIAS
FT                   PRVASSSYENLSAATSMAYLPQTLVLCDLRHDDASDIVQPPRWRLKERMKTGCVALVMC
FT                   LHITVDPPDVIKISPCARLECWIDPFSMFPPRRALEAIGQNLSIQYERWLARARYKVEL
FT                   DPTKDDVRKLCLSCRKYAKTERVLFHYNGHGVPKPTPNGEIWVYNKNFTQYIPLPVSEL
FT                   DSWLKTPTIYVFDCSAARVILNAFAELHEGESSGPPKDCILLAACDVHETLPQSVEFPA
FT                   DVFTSCLTTPINIALKWFCRRSLLKEFIDESLIDRIPGRQNDRKTLLGELNWIFTAVTD
FT                   TIAWNVLPRELFQRLFRQDLLVASLFRNFLLAERIMRSGNCTPISHPMLPPTHQHHMWD
FT                   AWDMAAEICLSQLPQFFLDPNTEFQPSSFFTEQLTAFEVWLDHGSEHKKPPEQLPIVLQ
FT                   VLLSQCHRYRALVLLGRFLDMGPWAVDLALSVGIYPCVVKLLQTTTIELRQILVFIWTK
FT                   ILALDKSCQVDLVKDRGHIYFIRFLDSSDAFPEQRAMAAFILAVIVDGYKRGQESCLEA
FT                   NLIAVCLGHLEATQLCDPPPEPLFLQWLCLCLGKLWEDYLEAQIMGREANASEKLIPLL
FT                   SEAQPEVRAAAVFALGTLLDVGFDSGKGVCDEEFDDDENIVEDIIIKSLLDVVSDGSPL
FT                   VRTEVAVALARFAFGHKQHLKSVADSYWKPQNSLRTSLPSMAKFHDSGTSIVASSDMGS
FT                   LTRASPDSQPVAREGRISSSLQEPFSGLMQGSPLADDSSLHSDVGIIHDGVSNGVVHQP
FT                   RPLDNAIYSQSVLAMFTLAKDPSPRIASLGRRVLSVIGIEQIVAKPSKSNGRPGEAASA
FT                   SHTPLAGLVRSSSWFDMHTGHLPLTFRTPPVSPPQTSYLTGLRRVCSLELRPHLLGSPD
FT                   SGLADPILGVSGSERSLLPQSTIYNWSCGHFSKPLLGGADANEEIAAQREEKKKFSLEH
FT                   IAKCQHSSISGLSNIPIANWDTKFETGTKTALLHPFSPIVVAADENERIRVWNYEEATL
FT                   LNGFDNNDFPDKGISNLCLVNELDDSLLLVASCDGSVRIWKDYATKGRQKLVTGFSSIQ
FT                   GQKPGASGLNAVVDWQQQSGYLYVSGESLSIMVWDLDKEQLVKSMPFESGCSVTALSAS
FT                   QVHGSQLAAGFADGSVRLYDVRTPDFLVCATRPHQRVEKVVGLSFQPGLDPAKIVSASQ
FT                   AGDIQFLDLRRPKETYLTIDAHRGSLTALGVHRHAPIIASGSAKQLIKVFSLKGEQLGI
FT                   IKYHTSFMGQQIGPVSCLAFHPYQMLLAAGAAGSFVSLYTHHNTQLPR"
     MALGDLMVSR LSQSSVTVVT NHLYDDDDNC ASSAHDDSRV SIIASPRVAS SSYENLSAAT        60
     SMAYLPQTLV LCDLRHDDAS DIVQPPRWRL KERMKTGCVA LVMCLHITVD PPDVIKISPC       120
     ARLECWIDPF SMFPPRRALE AIGQNLSIQY ERWLARARYK VELDPTKDDV RKLCLSCRKY       180
     AKTERVLFHY NGHGVPKPTP NGEIWVYNKN FTQYIPLPVS ELDSWLKTPT IYVFDCSAAR       240
     VILNAFAELH EGESSGPPKD CILLAACDVH ETLPQSVEFP ADVFTSCLTT PINIALKWFC       300
     RRSLLKEFID ESLIDRIPGR QNDRKTLLGE LNWIFTAVTD TIAWNVLPRE LFQRLFRQDL       360
     LVASLFRNFL LAERIMRSGN CTPISHPMLP PTHQHHMWDA WDMAAEICLS QLPQFFLDPN       420
     TEFQPSSFFT EQLTAFEVWL DHGSEHKKPP EQLPIVLQVL LSQCHRYRAL VLLGRFLDMG       480
     PWAVDLALSV GIYPCVVKLL QTTTIELRQI LVFIWTKILA LDKSCQVDLV KDRGHIYFIR       540
     FLDSSDAFPE QRAMAAFILA VIVDGYKRGQ ESCLEANLIA VCLGHLEATQ LCDPPPEPLF       600
     LQWLCLCLGK LWEDYLEAQI MGREANASEK LIPLLSEAQP EVRAAAVFAL GTLLDVGFDS       660
     GKGVCDEEFD DDENIVEDII IKSLLDVVSD GSPLVRTEVA VALARFAFGH KQHLKSVADS       720
     YWKPQNSLRT SLPSMAKFHD SGTSIVASSD MGSLTRASPD SQPVAREGRI SSSLQEPFSG       780
     LMQGSPLADD SSLHSDVGII HDGVSNGVVH QPRPLDNAIY SQSVLAMFTL AKDPSPRIAS       840
     LGRRVLSVIG IEQIVAKPSK SNGRPGEAAS ASHTPLAGLV RSSSWFDMHT GHLPLTFRTP       900
     PVSPPQTSYL TGLRRVCSLE LRPHLLGSPD SGLADPILGV SGSERSLLPQ STIYNWSCGH       960
     FSKPLLGGAD ANEEIAAQRE EKKKFSLEHI AKCQHSSISG LSNIPIANWD TKFETGTKTA      1020
     LLHPFSPIVV AADENERIRV WNYEEATLLN GFDNNDFPDK GISNLCLVNE LDDSLLLVAS      1080
     CDGSVRIWKD YATKGRQKLV TGFSSIQGQK PGASGLNAVV DWQQQSGYLY VSGESLSIMV      1140
     WDLDKEQLVK SMPFESGCSV TALSASQVHG SQLAAGFADG SVRLYDVRTP DFLVCATRPH      1200
     QRVEKVVGLS FQPGLDPAKI VSASQAGDIQ FLDLRRPKET YLTIDAHRGS LTALGVHRHA      1260
     PIIASGSAKQ LIKVFSLKGE QLGIIKYHTS FMGQQIGPVS CLAFHPYQML LAAGAAGSFV      1320
     SLYTHHNTQL PR                                                          1332
//

If you have problems or comments...

PBIL Back to PBIL home page