(data stored in ACNUC13479 zone)

EMBL: CP002688.PE153

CP002688.PE153       Location/Qualifiers
FT   CDS             complement(join(302365..302640,302729..303067,
FT                   303141..303560,304001..304129))
FT                   /codon_start=1
FT                   /gene_synonym="T20L15.50"
FT                   /gene_synonym="T20L15_50"
FT                   /locus_tag="AT5G01780"
FT                   /product="2-oxoglutarate-dependent dioxygenase family
FT                   protein"
FT                   /note="2-oxoglutarate-dependent dioxygenase family protein;
FT                   FUNCTIONS IN: oxidoreductase activity; LOCATED IN:
FT                   cellular_component unknown; EXPRESSED IN: 21 plant
FT                   structures; EXPRESSED DURING: 11 growth stages; CONTAINS
FT                   InterPro DOMAIN/s: Oxoglutarate/iron-dependent oxygenase
FT                   (InterPro:IPR005123); BEST Arabidopsis thaliana protein
FT                   match is: 2-oxoglutarate-dependent dioxygenase family
FT                   protein (TAIR:AT3G14160.1); Has 30201 Blast hits to 17322
FT                   proteins in 780 species: Archae - 12; Bacteria - 1396;
FT                   Metazoa - 17338; Fungi - 3422; Plants - 5037; Viruses - 0;
FT                   Other Eukaryotes - 2996 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01780"
FT                   /db_xref="GOA:F4KAV1"
FT                   /db_xref="InterPro:IPR004574"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR027450"
FT                   /db_xref="InterPro:IPR037151"
FT                   /db_xref="UniProtKB/TrEMBL:F4KAV1"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EL213056.1,INSD:ES075606.1,INSD:BP636128.1,
FT                   INSD:EL180229.1,INSD:ES066752.1,INSD:ES079460.1,
FT                   INSD:ES103227.1,INSD:AU036569.1,INSD:ES133826.1,
FT                   INSD:ES048503.1,INSD:EG498571.1,INSD:ES060807.1,
FT                   INSD:EG498572.1,INSD:BP624617.1,INSD:EL258554.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:BX830679.1"
FT                   /protein_id="AED90390.1"
FT                   /translation="MLNSIHRSFHLTSRHQIVLRLCSPSASRTIMSSSPHSPIPKTHRN
FT                   LGCKNRRRRRASRFLHEESNGTTFEVGAGIGSPTSMVHFDSTNPSSSSKSSQSQNLKIR
FT                   KVRNHRNSGFKSRDQSPQRIKDPPPFDICSSVLERNDTSIKDWILADETNRETVEVSNK
FT                   HKVIRPGMVLLKDFLTPDIQVDIVKTCRELGVKPTGFYQPGYSVGSKLHLQMMCLGRNW
FT                   DPQTKYRKNTDIDSKAPEIPVTFNVLVEKAIREAHALIDRESGTEDAERILPVMSPDIC
FT                   IVNFYSETGRLGLHQDRDESEESIARGLPIVSFSIGDSAEFLYGEKRDVEEAQGVILES
FT                   GDVLIFGGESRMIFHGVKSIIPNSAPMSLLNESKLRTGRLNLTFRHF"
     MLNSIHRSFH LTSRHQIVLR LCSPSASRTI MSSSPHSPIP KTHRNLGCKN RRRRRASRFL        60
     HEESNGTTFE VGAGIGSPTS MVHFDSTNPS SSSKSSQSQN LKIRKVRNHR NSGFKSRDQS       120
     PQRIKDPPPF DICSSVLERN DTSIKDWILA DETNRETVEV SNKHKVIRPG MVLLKDFLTP       180
     DIQVDIVKTC RELGVKPTGF YQPGYSVGSK LHLQMMCLGR NWDPQTKYRK NTDIDSKAPE       240
     IPVTFNVLVE KAIREAHALI DRESGTEDAE RILPVMSPDI CIVNFYSETG RLGLHQDRDE       300
     SEESIARGLP IVSFSIGDSA EFLYGEKRDV EEAQGVILES GDVLIFGGES RMIFHGVKSI       360
     IPNSAPMSLL NESKLRTGRL NLTFRHF                                           387
//

If you have problems or comments...

PBIL Back to PBIL home page