(data stored in ACNUC13479 zone)

EMBL: CP002688.PE154

CP002688.PE154       Location/Qualifiers
FT   CDS             complement(join(302365..302640,302729..303067,
FT                   303141..303725,304001..304129))
FT                   /codon_start=1
FT                   /gene_synonym="T20L15.50"
FT                   /gene_synonym="T20L15_50"
FT                   /locus_tag="AT5G01780"
FT                   /product="2-oxoglutarate-dependent dioxygenase family
FT                   protein"
FT                   /note="2-oxoglutarate-dependent dioxygenase family protein;
FT                   LOCATED IN: cellular_component unknown; EXPRESSED IN: 21
FT                   plant structures; EXPRESSED DURING: 11 growth stages; BEST
FT                   Arabidopsis thaliana protein match is:
FT                   2-oxoglutarate-dependent dioxygenase family protein
FT                   (TAIR:AT3G14160.1)."
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01780"
FT                   /db_xref="GOA:F4KAV2"
FT                   /db_xref="InterPro:IPR004574"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR027450"
FT                   /db_xref="InterPro:IPR037151"
FT                   /db_xref="UniProtKB/TrEMBL:F4KAV2"
FT                   /protein_id="AED90391.1"
FT                   /translation="MLNSIHRSFHLTSRHQIVLRLCSPSASRTIMSSSPHSPIPKTHTA
FT                   SLDSLNDYEEQFPPLTGGSKTKKFYLGSTNPSTPCQSSQLQNWTSGKDALSLQRNLGCK
FT                   NRRRRRASRFLHEESNGTTFEVGAGIGSPTSMVHFDSTNPSSSSKSSQSQNLKIRKVRN
FT                   HRNSGFKSRDQSPQRIKDPPPFDICSSVLERNDTSIKDWILADETNRETVEVSNKHKVI
FT                   RPGMVLLKDFLTPDIQVDIVKTCRELGVKPTGFYQPGYSVGSKLHLQMMCLGRNWDPQT
FT                   KYRKNTDIDSKAPEIPVTFNVLVEKAIREAHALIDRESGTEDAERILPVMSPDICIVNF
FT                   YSETGRLGLHQDRDESEESIARGLPIVSFSIGDSAEFLYGEKRDVEEAQGVILESGDVL
FT                   IFGGESRMIFHGVKSIIPNSAPMSLLNESKLRTGRLNLTFRHF"
     MLNSIHRSFH LTSRHQIVLR LCSPSASRTI MSSSPHSPIP KTHTASLDSL NDYEEQFPPL        60
     TGGSKTKKFY LGSTNPSTPC QSSQLQNWTS GKDALSLQRN LGCKNRRRRR ASRFLHEESN       120
     GTTFEVGAGI GSPTSMVHFD STNPSSSSKS SQSQNLKIRK VRNHRNSGFK SRDQSPQRIK       180
     DPPPFDICSS VLERNDTSIK DWILADETNR ETVEVSNKHK VIRPGMVLLK DFLTPDIQVD       240
     IVKTCRELGV KPTGFYQPGY SVGSKLHLQM MCLGRNWDPQ TKYRKNTDID SKAPEIPVTF       300
     NVLVEKAIRE AHALIDRESG TEDAERILPV MSPDICIVNF YSETGRLGLH QDRDESEESI       360
     ARGLPIVSFS IGDSAEFLYG EKRDVEEAQG VILESGDVLI FGGESRMIFH GVKSIIPNSA       420
     PMSLLNESKL RTGRLNLTFR HF                                                442
//

If you have problems or comments...

PBIL Back to PBIL home page