(data stored in ACNUC13479 zone)

EMBL: CP002688.PE155

CP002688.PE155       Location/Qualifiers
FT   CDS             complement(join(302365..302640,302729..303067,
FT                   303141..303449))
FT                   /codon_start=1
FT                   /gene_synonym="T20L15.50"
FT                   /gene_synonym="T20L15_50"
FT                   /locus_tag="AT5G01780"
FT                   /product="2-oxoglutarate-dependent dioxygenase family
FT                   protein"
FT                   /db_xref="GOA:A0A1P8BHF5"
FT                   /db_xref="InterPro:IPR004574"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR027450"
FT                   /db_xref="InterPro:IPR037151"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1P8BHF5"
FT                   /protein_id="ANM71029.1"
FT                   /translation="MVHFDSTNPSSSSKSSQSQNLKIRKVRNHRNSGFKSRDQSPQRIK
FT                   DPPPFDICSSVLERNDTSIKDWILADETNRETVEVSNKHKVIRPGMVLLKDFLTPDIQV
FT                   DIVKTCRELGVKPTGFYQPGYSVGSKLHLQMMCLGRNWDPQTKYRKNTDIDSKAPEIPV
FT                   TFNVLVEKAIREAHALIDRESGTEDAERILPVMSPDICIVNFYSETGRLGLHQDRDESE
FT                   ESIARGLPIVSFSIGDSAEFLYGEKRDVEEAQGVILESGDVLIFGGESRMIFHGVKSII
FT                   PNSAPMSLLNESKLRTGRLNLTFRHF"
     MVHFDSTNPS SSSKSSQSQN LKIRKVRNHR NSGFKSRDQS PQRIKDPPPF DICSSVLERN        60
     DTSIKDWILA DETNRETVEV SNKHKVIRPG MVLLKDFLTP DIQVDIVKTC RELGVKPTGF       120
     YQPGYSVGSK LHLQMMCLGR NWDPQTKYRK NTDIDSKAPE IPVTFNVLVE KAIREAHALI       180
     DRESGTEDAE RILPVMSPDI CIVNFYSETG RLGLHQDRDE SEESIARGLP IVSFSIGDSA       240
     EFLYGEKRDV EEAQGVILES GDVLIFGGES RMIFHGVKSI IPNSAPMSLL NESKLRTGRL       300
     NLTFRHF                                                                 307
//

If you have problems or comments...

PBIL Back to PBIL home page