(data stored in ACNUC13479 zone)

EMBL: CP002688.PE157

CP002688.PE157       Location/Qualifiers
FT   CDS             complement(join(302684..303067,303141..303725,
FT                   304001..304129))
FT                   /codon_start=1
FT                   /gene_synonym="T20L15.50"
FT                   /gene_synonym="T20L15_50"
FT                   /locus_tag="AT5G01780"
FT                   /product="2-oxoglutarate-dependent dioxygenase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01780"
FT                   /db_xref="GOA:A0A1P8BHF6"
FT                   /db_xref="InterPro:IPR004574"
FT                   /db_xref="InterPro:IPR027450"
FT                   /db_xref="InterPro:IPR037151"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1P8BHF6"
FT                   /protein_id="ANM71031.1"
FT                   /translation="MLNSIHRSFHLTSRHQIVLRLCSPSASRTIMSSSPHSPIPKTHTA
FT                   SLDSLNDYEEQFPPLTGGSKTKKFYLGSTNPSTPCQSSQLQNWTSGKDALSLQRNLGCK
FT                   NRRRRRASRFLHEESNGTTFEVGAGIGSPTSMVHFDSTNPSSSSKSSQSQNLKIRKVRN
FT                   HRNSGFKSRDQSPQRIKDPPPFDICSSVLERNDTSIKDWILADETNRETVEVSNKHKVI
FT                   RPGMVLLKDFLTPDIQVDIVKTCRELGVKPTGFYQPGYSVGSKLHLQMMCLGRNWDPQT
FT                   KYRKNTDIDSKAPEIPVTFNVLVEKAIREAHALIDRESGTEDAERILPVMSPDICIVNF
FT                   YSETGRLGLHQVLCSLTLNLFEGFS"
     MLNSIHRSFH LTSRHQIVLR LCSPSASRTI MSSSPHSPIP KTHTASLDSL NDYEEQFPPL        60
     TGGSKTKKFY LGSTNPSTPC QSSQLQNWTS GKDALSLQRN LGCKNRRRRR ASRFLHEESN       120
     GTTFEVGAGI GSPTSMVHFD STNPSSSSKS SQSQNLKIRK VRNHRNSGFK SRDQSPQRIK       180
     DPPPFDICSS VLERNDTSIK DWILADETNR ETVEVSNKHK VIRPGMVLLK DFLTPDIQVD       240
     IVKTCRELGV KPTGFYQPGY SVGSKLHLQM MCLGRNWDPQ TKYRKNTDID SKAPEIPVTF       300
     NVLVEKAIRE AHALIDRESG TEDAERILPV MSPDICIVNF YSETGRLGLH QVLCSLTLNL       360
     FEGFS                                                                   365
//

If you have problems or comments...

PBIL Back to PBIL home page