(data stored in ACNUC13479 zone)

EMBL: CP002688.PE158

CP002688.PE158       Location/Qualifiers
FT   CDS             complement(305057..305683)
FT                   /codon_start=1
FT                   /gene_synonym="T20L15.60"
FT                   /gene_synonym="T20L15_60"
FT                   /locus_tag="AT5G01790"
FT                   /product="hypothetical protein"
FT                   /note="unknown protein; FUNCTIONS IN: molecular_function
FT                   unknown; INVOLVED IN: biological_process unknown; LOCATED
FT                   IN: chloroplast; EXPRESSED IN: 19 plant structures;
FT                   EXPRESSED DURING: 13 growth stages; Has 121 Blast hits to
FT                   121 proteins in 12 species: Archae - 0; Bacteria - 0;
FT                   Metazoa - 0; Fungi - 0; Plants - 121; Viruses - 0; Other
FT                   Eukaryotes - 0 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01790"
FT                   /db_xref="GOA:Q6NNJ2"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NNJ2"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EG516967.1,INSD:ES052854.1,INSD:ES087009.1,
FT                   INSD:ES152420.1,INSD:AV556068.1,INSD:DR382885.1,
FT                   INSD:DR358030.1,INSD:ES165735.1,INSD:EL969275.1,
FT                   INSD:ES046949.1,INSD:ES151941.1,INSD:AV567657.1,
FT                   INSD:T03962.1,INSD:EG516966.1,INSD:EL986476.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BT010833.1,INSD:BX833131.1,INSD:BX833182.1,
FT                   INSD:BT011294.1,INSD:BT015487.1,INSD:BX833276.1,
FT                   INSD:BX833153.1"
FT                   /protein_id="AED90392.1"
FT                   /translation="MHTSLPLFPSLSLSHSPKTIMPNAGSERAASLSLKKQDTATFSGK
FT                   LPSTKQRFSSVSAACPSFRIYYYDGAAGAVPFEWESHPGTPKHPSSELPTLPPLTPPPS
FT                   HFSFSGDQIRRRSKKSTKKILALIPTRLFWLSGDHNGKAKKLSASSPPSLSERVLIDEN
FT                   EYDLFKFQTERNVMRRFSSFDSSADYPIQRSQSTSCFGIRRCFLC"
     MHTSLPLFPS LSLSHSPKTI MPNAGSERAA SLSLKKQDTA TFSGKLPSTK QRFSSVSAAC        60
     PSFRIYYYDG AAGAVPFEWE SHPGTPKHPS SELPTLPPLT PPPSHFSFSG DQIRRRSKKS       120
     TKKILALIPT RLFWLSGDHN GKAKKLSASS PPSLSERVLI DENEYDLFKF QTERNVMRRF       180
     SSFDSSADYP IQRSQSTSCF GIRRCFLC                                          208
//

If you have problems or comments...

PBIL Back to PBIL home page