(data stored in ACNUC13479 zone)

EMBL: CP002688.PE159

CP002688.PE159       Location/Qualifiers
FT   CDS             join(307422..307509,307732..307880,307976..308176,
FT                   308316..308375,308491..308646)
FT                   /codon_start=1
FT                   /gene_synonym="T20L15.70"
FT                   /gene_synonym="T20L15_70"
FT                   /locus_tag="AT5G01800"
FT                   /product="saposin B domain-containing protein"
FT                   /note="saposin B domain-containing protein; FUNCTIONS IN:
FT                   molecular_function unknown; INVOLVED IN: N-terminal protein
FT                   myristoylation, lipid metabolic process; LOCATED IN:
FT                   endomembrane system; EXPRESSED IN: 23 plant structures;
FT                   EXPRESSED DURING: 15 growth stages; CONTAINS InterPro
FT                   DOMAIN/s: Saposin B (InterPro:IPR008139), Saposin-like
FT                   (InterPro:IPR011001), Saposin-like type B, 1
FT                   (InterPro:IPR007856), Saposin-like type B, 2
FT                   (InterPro:IPR008138); BEST Arabidopsis thaliana protein
FT                   match is: saposin B domain-containing protein
FT                   (TAIR:AT3G51730.1); Has 1807 Blast hits to 1807 proteins in
FT                   277 species: Archae - 0; Bacteria - 0; Metazoa - 736; Fungi
FT                   - 347; Plants - 385; Viruses - 0; Other Eukaryotes - 339
FT                   (source: NCBI BLink)."
FT                   /db_xref="GOA:Q9LZW6"
FT                   /db_xref="InterPro:IPR007856"
FT                   /db_xref="InterPro:IPR008138"
FT                   /db_xref="InterPro:IPR008139"
FT                   /db_xref="InterPro:IPR011001"
FT                   /db_xref="UniProtKB/TrEMBL:Q9LZW6"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:AV786281.1,INSD:ES155587.1,INSD:CF651301.1,
FT                   INSD:BP820469.2,INSD:DR373625.1,INSD:ES156334.1,
FT                   INSD:CA782013.1,INSD:EL155867.1,INSD:BP623188.1,
FT                   INSD:EH913951.1,INSD:BP810596.1,INSD:ES123589.1,
FT                   INSD:EL095419.1,INSD:ES095499.1,INSD:BP605571.1,
FT                   INSD:DR251561.1,INSD:T46286.1,INSD:EH882448.1,
FT                   INSD:ES082269.1,INSD:EL156870.1,INSD:EL280246.1,
FT                   INSD:ES139225.1,INSD:AV536823.1,INSD:CB261910.1,
FT                   INSD:ES078455.1,INSD:EL330829.1,INSD:EH824011.1,
FT                   INSD:AV539745.1,INSD:EL252815.1,INSD:EH798239.1,
FT                   INSD:EL076095.1,INSD:EL310237.1,INSD:EL332483.1,
FT                   INSD:EL037097.1,INSD:EH934565.1,INSD:Z17475.1,
FT                   INSD:EL285752.1,INSD:ES212048.1,INSD:CF651302.1,
FT                   INSD:EH819068.1,INSD:EL208794.1,INSD:BP615397.1,
FT                   INSD:EL983588.1,INSD:ES100109.1,INSD:EH977072.1,
FT                   INSD:BP851133.2,INSD:EL975354.1,INSD:ES190736.1,
FT                   INSD:EH967478.1,INSD:EL095637.1,INSD:EH814423.1,
FT                   INSD:EL189751.1,INSD:AA720259.1,INSD:ES166906.1,
FT                   INSD:EH885076.1,INSD:EH862378.1,INSD:DR251562.1,
FT                   INSD:EL327821.1,INSD:EH848374.1,INSD:EL050696.1,
FT                   INSD:EH889506.1,INSD:EL206675.1,INSD:T43403.1,
FT                   INSD:EL254135.1,INSD:ES175802.1,INSD:EL056448.1,
FT                   INSD:EH803510.1,INSD:EL021464.1,INSD:ES182599.1,
FT                   INSD:EL969371.1,INSD:ES085984.1,INSD:EG495642.1,
FT                   INSD:BP588159.1,INSD:EL065598.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BX834065.1,INSD:AY056420.1,INSD:BX830665.1,
FT                   INSD:AY081711.1,INSD:BX833129.1"
FT                   /protein_id="AED90393.1"
FT                   /translation="MGGRFGVLLVLFLLSWSCHATNPILLEPFESAHDDNQVCELCDKY
FT                   VTLVIDYLQDYDNQNELVEALHISCSQIPPLKKQCLSMVDHYTQLFFTQVSTIKSDQIC
FT                   KRLNLCQAVTPAFASQVHQGNCEACRETVSEVVTKLKDPETKLKIIRLLLKECKSLNNY
FT                   QDKCKKMVFEYGPLMLTDLQKFLEKKDVCTILHVCPGPATHRDYVPAVESLADS"
     MGGRFGVLLV LFLLSWSCHA TNPILLEPFE SAHDDNQVCE LCDKYVTLVI DYLQDYDNQN        60
     ELVEALHISC SQIPPLKKQC LSMVDHYTQL FFTQVSTIKS DQICKRLNLC QAVTPAFASQ       120
     VHQGNCEACR ETVSEVVTKL KDPETKLKII RLLLKECKSL NNYQDKCKKM VFEYGPLMLT       180
     DLQKFLEKKD VCTILHVCPG PATHRDYVPA VESLADS                                217
//

If you have problems or comments...

PBIL Back to PBIL home page