(data stored in ACNUC13479 zone)

EMBL: CP002688.PE16

CP002688.PE16        Location/Qualifiers
FT   CDS             join(22740..23054,23136..23271,23359..23492,23580..23771,
FT                   23858..24130)
FT                   /codon_start=1
FT                   /gene="BSK10"
FT                   /gene_synonym="brassinosteroid-signaling kinase 10"
FT                   /gene_synonym="F7J8.40"
FT                   /gene_synonym="F7J8_40"
FT                   /locus_tag="AT5G01060"
FT                   /product="kinase with tetratricopeptide repeat
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01060"
FT                   /db_xref="GOA:A0A1P8BE32"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001245"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1P8BE32"
FT                   /protein_id="ANM69869.1"
FT                   /translation="MGCICFKSWRRSSSSPSITSTVIDDLENVREYDADDDGGHYPLIF
FT                   REFSLEQLRIATDGFSAGNIVSEHNDSVPNIVYKGKLGDGRRIAVKRFQRLSWPDPFEF
FT                   INEAQAVGRLRSEHMANLIGCCCDDNERLLVAEYMPNGTLAKHLFHWEKRPMKWEMRLK
FT                   VALHTARALEYCNDKGIDLYHDLNPYRIMFDKTGIPKLSCFGLMKNSHEGKIYSTNLAF
FT                   APPEYLRLGTVIAESVTFSFGTLLLDLMSGRHIPPNHALDLFRGKNYLVLMDSALDGQF
FT                   SDEDRTELIHVASRCFKTEPEERPSIKFLKATLSRLQKRAKLCPINVKRPMSVRVTLSI
FT                   YSRIKNSLS"
     MGCICFKSWR RSSSSPSITS TVIDDLENVR EYDADDDGGH YPLIFREFSL EQLRIATDGF        60
     SAGNIVSEHN DSVPNIVYKG KLGDGRRIAV KRFQRLSWPD PFEFINEAQA VGRLRSEHMA       120
     NLIGCCCDDN ERLLVAEYMP NGTLAKHLFH WEKRPMKWEM RLKVALHTAR ALEYCNDKGI       180
     DLYHDLNPYR IMFDKTGIPK LSCFGLMKNS HEGKIYSTNL AFAPPEYLRL GTVIAESVTF       240
     SFGTLLLDLM SGRHIPPNHA LDLFRGKNYL VLMDSALDGQ FSDEDRTELI HVASRCFKTE       300
     PEERPSIKFL KATLSRLQKR AKLCPINVKR PMSVRVTLSI YSRIKNSLS                   349
//

If you have problems or comments...

PBIL Back to PBIL home page