(data stored in ACNUC13479 zone)

EMBL: CP002688.PE162

CP002688.PE162       Location/Qualifiers
FT   CDS             join(310460..311308,311444..311725)
FT                   /codon_start=1
FT                   /gene="CIPK15"
FT                   /gene_synonym="ATPK10"
FT                   /gene_synonym="CBL-interacting protein kinase 15"
FT                   /gene_synonym="PKS3"
FT                   /gene_synonym="PROTEIN KINASE 10"
FT                   /gene_synonym="SERINE/THREONINE PROTEIN KINASE 10"
FT                   /gene_synonym="SIP2"
FT                   /gene_synonym="SMALL AND BASIC INTRINSIC PROTEIN 2"
FT                   /gene_synonym="SNF1-RELATED PROTEIN KINASE 3.1"
FT                   /gene_synonym="SNRK3.1"
FT                   /gene_synonym="SOS3-INTERACTING PROTEIN 2"
FT                   /gene_synonym="T20L15.80"
FT                   /gene_synonym="T20L15_80"
FT                   /locus_tag="AT5G01810"
FT                   /product="CBL-interacting protein kinase 15"
FT                   /note="CBL-interacting protein kinase 15 (CIPK15); CONTAINS
FT                   InterPro DOMAIN/s: Protein kinase, ATP binding site
FT                   (InterPro:IPR017441), Serine/threonine-protein kinase
FT                   domain (InterPro:IPR002290), Serine/threonine-protein
FT                   kinase-like domain (InterPro:IPR017442),
FT                   Serine/threonine-protein kinase, active site
FT                   (InterPro:IPR008271), Protein kinase-like domain
FT                   (InterPro:IPR011009), NAF domain (InterPro:IPR004041),
FT                   CBL-interacting protein kinase (InterPro:IPR020660),
FT                   Protein kinase, catalytic domain (InterPro:IPR000719),
FT                   Tyrosine-protein kinase, catalytic domain
FT                   (InterPro:IPR020635), Calcium/calmodulin-dependent protein
FT                   kinase-like (InterPro:IPR020636); BEST Arabidopsis thaliana
FT                   protein match is: CBL-interacting protein kinase 20
FT                   (TAIR:AT5G45820.1)."
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01810"
FT                   /db_xref="GOA:F4KAV7"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR004041"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:F4KAV7"
FT                   /protein_id="AED90396.1"
FT                   /translation="MEKKGSVLMLRYEVGKFLGQGTFAKVYHARHLKTGDSVAIKVIDK
FT                   ERILKVGMTEQIKREISAMRLLRHPNIVELHEVMATKSKIYFVMEHVKGGELFNKVSTG
FT                   KLREDVARKYFQQLVRAVDFCHSRGVCHRDLKPENLLLDEHGNLKISDFGLSALSDSRR
FT                   QDGLLHTTCGTPAYVAPEVISRNGYDGFKADVWSCGVILFVLLAGYLPFRDSNLMELYK
FT                   KIGKAEVKFPNWLAPGAKRLLKRILDPNPNTRVSTEKIMKSSWFRKGLQEEVKESVEEE
FT                   TEEEMRFTSNREASEITEKLVEIGKDLKMKVRKKEHEWRVKMSAEATVVEAEVFEIAPS
FT                   YHMVVLKKSGGDTAEYKRVMKESIRPALIDFVLAWH"
     MEKKGSVLML RYEVGKFLGQ GTFAKVYHAR HLKTGDSVAI KVIDKERILK VGMTEQIKRE        60
     ISAMRLLRHP NIVELHEVMA TKSKIYFVME HVKGGELFNK VSTGKLREDV ARKYFQQLVR       120
     AVDFCHSRGV CHRDLKPENL LLDEHGNLKI SDFGLSALSD SRRQDGLLHT TCGTPAYVAP       180
     EVISRNGYDG FKADVWSCGV ILFVLLAGYL PFRDSNLMEL YKKIGKAEVK FPNWLAPGAK       240
     RLLKRILDPN PNTRVSTEKI MKSSWFRKGL QEEVKESVEE ETEEEMRFTS NREASEITEK       300
     LVEIGKDLKM KVRKKEHEWR VKMSAEATVV EAEVFEIAPS YHMVVLKKSG GDTAEYKRVM       360
     KESIRPALID FVLAWH                                                       376
//

If you have problems or comments...

PBIL Back to PBIL home page