(data stored in ACNUC13479 zone)

EMBL: CP002688.PE166

CP002688.PE166       Location/Qualifiers
FT   CDS             join(332829..333336,333420..333544,333639..333797,
FT                   333899..334180)
FT                   /codon_start=1
FT                   /gene_synonym="T20L15.120"
FT                   /gene_synonym="T20L15_120"
FT                   /locus_tag="AT5G01850"
FT                   /product="Protein kinase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01850"
FT                   /db_xref="GOA:A0A1P8BGL4"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001245"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1P8BGL4"
FT                   /protein_id="ANM70739.1"
FT                   /translation="MSSDDTIEESLLVDPKLLFIGSKIGEGAHGKVYQGRYGRQIVAIK
FT                   VVNRGSKPDQQSSLESRFVREVNMMSRVQHHNLVKVSLLLSSLSLLSILLLEYTISIWQ
FT                   FIGACKDPLMVIVTELLPGMSLRKYLTSIRPQLLHLPLALSFALDIARALHCLHANGII
FT                   HRDLKPDNLLLTENHKSVKLADFGLAREESVTEMMTAETGTYRWMAPELYSTVTLRQGE
FT                   KKHYNNKVDVYSFGIVLWELLTNRMPFEGMSNLQAAYAAAFKQERPVMPEGISPSLAFI
FT                   VQSCWVEDPNMRPSFSQIIRLLNEFLLTLTPPPPQPLPETATNRTNGRAITEFSIRPKG
FT                   KFAFIRQLFAAKRNINS"
     MSSDDTIEES LLVDPKLLFI GSKIGEGAHG KVYQGRYGRQ IVAIKVVNRG SKPDQQSSLE        60
     SRFVREVNMM SRVQHHNLVK VSLLLSSLSL LSILLLEYTI SIWQFIGACK DPLMVIVTEL       120
     LPGMSLRKYL TSIRPQLLHL PLALSFALDI ARALHCLHAN GIIHRDLKPD NLLLTENHKS       180
     VKLADFGLAR EESVTEMMTA ETGTYRWMAP ELYSTVTLRQ GEKKHYNNKV DVYSFGIVLW       240
     ELLTNRMPFE GMSNLQAAYA AAFKQERPVM PEGISPSLAF IVQSCWVEDP NMRPSFSQII       300
     RLLNEFLLTL TPPPPQPLPE TATNRTNGRA ITEFSIRPKG KFAFIRQLFA AKRNINS          357
//

If you have problems or comments...

PBIL Back to PBIL home page