(data stored in ACNUC13479 zone)

EMBL: CP002688.PE167

CP002688.PE167       Location/Qualifiers
FT   CDS             join(332829..333068,333141..333336,333420..333544,
FT                   333639..333797,333899..334180)
FT                   /codon_start=1
FT                   /gene_synonym="T20L15.120"
FT                   /gene_synonym="T20L15_120"
FT                   /locus_tag="AT5G01850"
FT                   /product="Protein kinase superfamily protein"
FT                   /note="Protein kinase superfamily protein; FUNCTIONS IN:
FT                   protein serine/threonine/tyrosine kinase activity, kinase
FT                   activity; INVOLVED IN: protein amino acid phosphorylation;
FT                   EXPRESSED IN: 22 plant structures; EXPRESSED DURING: 13
FT                   growth stages; CONTAINS InterPro DOMAIN/s: Protein kinase,
FT                   ATP binding site (InterPro:IPR017441),
FT                   Serine/threonine-protein kinase domain
FT                   (InterPro:IPR002290), Serine-threonine/tyrosine-protein
FT                   kinase (InterPro:IPR001245), Protein kinase-like domain
FT                   (InterPro:IPR011009), Serine/threonine-protein kinase,
FT                   active site (InterPro:IPR008271), Protein kinase, catalytic
FT                   domain (InterPro:IPR000719), Serine/threonine-protein
FT                   kinase, ATN1-like (InterPro:IPR015784); BEST Arabidopsis
FT                   thaliana protein match is: Protein kinase superfamily
FT                   protein (TAIR:AT3G27560.1); Has 131148 Blast hits to 129643
FT                   proteins in 5072 species: Archae - 162; Bacteria - 15033;
FT                   Metazoa - 49603; Fungi - 12189; Plants - 33321; Viruses -
FT                   522; Other Eukaryotes - 20318 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01850"
FT                   /db_xref="EnsemblGenomes-Tr:AT5G01850.1"
FT                   /db_xref="GOA:Q8L6Y9"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001245"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:Q8L6Y9"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:ES215389.1,INSD:EL186897.1,INSD:AV560070.1,
FT                   INSD:ES001505.1,INSD:AV533466.1,INSD:EH981384.1,
FT                   INSD:EL083070.1,INSD:EL990112.1,INSD:AV830310.1,
FT                   INSD:EL974629.1,INSD:AV811144.1,INSD:AV440394.1,
FT                   INSD:ES079158.1,INSD:EL001430.1,INSD:ES066339.1,
FT                   INSD:BP866957.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BT002168.1,INSD:AY140072.1,INSD:BX830646.1"
FT                   /protein_id="AED90401.1"
FT                   /translation="MSSDDTIEESLLVDPKLLFIGSKIGEGAHGKVYQGRYGRQIVAIK
FT                   VVNRGSKPDQQSSLESRFVREVNMMSRVQHHNLVKFIGACKDPLMVIVTELLPGMSLRK
FT                   YLTSIRPQLLHLPLALSFALDIARALHCLHANGIIHRDLKPDNLLLTENHKSVKLADFG
FT                   LAREESVTEMMTAETGTYRWMAPELYSTVTLRQGEKKHYNNKVDVYSFGIVLWELLTNR
FT                   MPFEGMSNLQAAYAAAFKQERPVMPEGISPSLAFIVQSCWVEDPNMRPSFSQIIRLLNE
FT                   FLLTLTPPPPQPLPETATNRTNGRAITEFSIRPKGKFAFIRQLFAAKRNINS"
     MSSDDTIEES LLVDPKLLFI GSKIGEGAHG KVYQGRYGRQ IVAIKVVNRG SKPDQQSSLE        60
     SRFVREVNMM SRVQHHNLVK FIGACKDPLM VIVTELLPGM SLRKYLTSIR PQLLHLPLAL       120
     SFALDIARAL HCLHANGIIH RDLKPDNLLL TENHKSVKLA DFGLAREESV TEMMTAETGT       180
     YRWMAPELYS TVTLRQGEKK HYNNKVDVYS FGIVLWELLT NRMPFEGMSN LQAAYAAAFK       240
     QERPVMPEGI SPSLAFIVQS CWVEDPNMRP SFSQIIRLLN EFLLTLTPPP PQPLPETATN       300
     RTNGRAITEF SIRPKGKFAF IRQLFAAKRN INS                                    333
//

If you have problems or comments...

PBIL Back to PBIL home page