(data stored in ACNUC13479 zone)

EMBL: CP002688.PE168

CP002688.PE168       Location/Qualifiers
FT   CDS             335630..336277
FT                   /codon_start=1
FT                   /gene_synonym="T20L15.130"
FT                   /gene_synonym="T20L15_130"
FT                   /locus_tag="AT5G01860"
FT                   /product="C2H2 and C2HC zinc fingers superfamily protein"
FT                   /note="C2H2 and C2HC zinc fingers superfamily protein;
FT                   FUNCTIONS IN: sequence-specific DNA binding transcription
FT                   factor activity, zinc ion binding, nucleic acid binding;
FT                   INVOLVED IN: regulation of transcription; LOCATED IN:
FT                   intracellular, chloroplast; EXPRESSED IN: shoot, sepal,
FT                   root, leaf; EXPRESSED DURING: LP.02 two leaves visible,
FT                   petal differentiation and expansion stage; CONTAINS
FT                   InterPro DOMAIN/s: Zinc finger, C2H2-like
FT                   (InterPro:IPR015880), Zinc finger, C2H2-type
FT                   (InterPro:IPR007087); BEST Arabidopsis thaliana protein
FT                   match is: C2H2 and C2HC zinc fingers superfamily protein
FT                   (TAIR:AT5G27880.1); Has 1807 Blast hits to 1807 proteins in
FT                   277 species: Archae - 0; Bacteria - 0; Metazoa - 736; Fungi
FT                   - 347; Plants - 385; Viruses - 0; Other Eukaryotes - 339
FT                   (source: NCBI BLink)."
FT                   /db_xref="GOA:Q9LZW0"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="UniProtKB/TrEMBL:Q9LZW0"
FT                   /protein_id="AED90402.1"
FT                   /translation="MELNLSTPTSCSSSSISSSSHEAIPRTKGKTKEEVTAEPSKENQQ
FT                   RLEFRFLFNESSTRNEAKARVFACTFCKKEFSTSQALGGHQNAHKQERSLAKRRKEIEI
FT                   NYPELSIYSQYPPSGLSFSSSSSQYDLGVRYNPNIAKTTKPYPFNIFACRFGYRGGLNF
FT                   PPMSHLSVPKTDDLSINLISNLEGSIHDQAVKKDQPEADPCKDSDIDLSLKL"
     MELNLSTPTS CSSSSISSSS HEAIPRTKGK TKEEVTAEPS KENQQRLEFR FLFNESSTRN        60
     EAKARVFACT FCKKEFSTSQ ALGGHQNAHK QERSLAKRRK EIEINYPELS IYSQYPPSGL       120
     SFSSSSSQYD LGVRYNPNIA KTTKPYPFNI FACRFGYRGG LNFPPMSHLS VPKTDDLSIN       180
     LISNLEGSIH DQAVKKDQPE ADPCKDSDID LSLKL                                  215
//

If you have problems or comments...

PBIL Back to PBIL home page